KEGG   Amycolatopsis mediterranei U32: AMED_4097Help
Entry
AMED_4097         CDS       T01269                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4494322..4495719)
Genome map
AA seq 465 aa AA seqDB search
MKRSIAALAAAGATVLGGTAVLAMPQASAATQGCHVDYTVTNQWQGGFQAAVKVTNLGDA
ITGWLLRFTFPDAGQKVAQGWNATWAQSGATATAANADWNRTLTTGATTELGFTGTTTGA
NPVPASFTLNGVTCTGSTTTTTTPTTTTTTTTTPSPGGTPLAANGQLHVCGVHLCNEANR
AIQLRGMSTHGLQWFDSCYNDASLDALANDWHADLLRIAMYVQEKGYETNPAWFTDRVNS
LVGEAEERGMYAIVDFHTLTPGDPNYNLDRAKTFFAAVAARNAARKNVIYEIANEPNGVS
WGAIKSYAEQVIPVIRAADPDAVVIVGTRGWSSLGVSDGSNETEIVNNPVNAGNIMYTFH
FYAASHKDNYRATVSRAATRLPLFVTEFGTVTATGGGALDQASTTAWLDLLDQLQISYAN
WTYSDADESSAALQPGTCAGGDYGTGRLTASGALVRNRINTPDHF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctccatcgctgcgctggcggccgccggcgcgacggttctcggcggcaccgcc
gtgctggccatgccccaggcctcggccgccacgcaaggctgccacgtcgactacaccgtc
accaaccagtggcaaggcgggttccaggccgcggtcaaggtcaccaacctgggtgacgcg
atcaccggctggttgctccggttcaccttccccgacgccggccagaaggtcgcccagggc
tggaacgccacatgggcgcagtccggcgcgaccgccaccgcggccaacgccgactggaac
cggaccctcaccacgggtgccaccaccgaactcggcttcaccggcaccacgaccggcgcc
aacccggttccggcatccttcaccctgaacggcgtcacctgcaccgggtcgacgacgacc
acgaccacccccacgaccacgaccacgaccaccaccacgccctcccccggcggcacgccg
ctggccgcgaacgggcagctgcacgtctgcggtgtccacctgtgcaacgaggcgaaccgg
gcgatccagctgcgcggcatgagcacgcacggcctgcagtggttcgactcctgctacaac
gacgcgtccctggacgccctcgcgaacgactggcacgccgacctgctccgcatcgccatg
tacgtgcaggaaaagggctacgagaccaacccggcctggttcaccgaccgggtcaacagc
ctcgtcggcgaagccgaggaacgcgggatgtacgcgatcgtcgacttccacaccctcacc
ccgggcgatccgaactacaacctcgaccgcgccaagacgttcttcgcggcggtggccgcg
cgcaacgcggcccggaagaacgtgatctacgagatcgccaacgaacccaacggcgtcagc
tggggcgccatcaagagctacgccgaacaggtcatcccggtgatccgcgccgccgacccg
gacgctgtcgtgatcgtcggcacccgtggctggtcgtcgctcggcgtttccgacggctcg
aacgaaaccgagatcgtcaacaaccccgtcaacgccggcaacatcatgtacacgttccac
ttctacgccgccagccacaaggacaactaccgcgccacggtgagccgggcggccaccagg
ctgccgctgttcgtcacggagttcggcacggtgaccgccaccggcggcggcgcactggac
caggcgagcaccacggcctggctggatctgctcgaccagctgcagatcagttacgcgaac
tggacgtactccgacgccgacgaaagcagcgccgcgctgcaaccgggcacctgcgcgggc
ggcgactacggcaccggccggttgaccgcgtccggtgcactggtccggaaccgcatcaac
acgcccgaccacttctga

DBGET integrated database retrieval system