KEGG   Amycolatopsis mediterranei U32: AMED_4131Help
Entry
AMED_4131         CDS       T01269                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMED_4131 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AMED_4131 (cheB)
Enzymes [BR:amd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AMED_4131 (cheB)
Two-component system [BR:amd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AMED_4131 (cheB)
Bacterial motility proteins [BR:amd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AMED_4131 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4539437..4540465
Genome map
AA seq 342 aa AA seqDB search
MDAVPPFRRDLVVVGASAGGVEALRSLVSGLPADFPAAVLVAMHLGAGTQSALARILDRV
GPLPARTARHGAPLEPGTVQVAPPDRHLLTEDGTLVLTQGPTENGHRPAVNATFRSAALT
GGQRVIGVILSGALDDGAAGLRAIVDRGGLAVVQDPADALYRGMPESALALVDTEHVARV
VEIGAVLDKLVRMPVEPFEVPPPSDALLLEDRIAREAVRLGALTAAERSVGSGYTCPDCQ
GSLTEVDPVGRYRCRIGHAWSAPALLEAHSREFQLALMKALRALDEKAALARKLAAQTGT
TRPSGLAERYAASAREATDAAETLRRFLLDADREAAGDPASG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccgtgccgcctttccggcgtgacctcgtggtcgtcggtgcctccgccggcggg
gtcgaggccttgcggtccctggtgtccgggttgcccgccgatttcccggccgcggttctg
gtcgccatgcacctgggcgccgggacgcagagcgcgctggcccggattctcgaccgcgtg
ggcccgctgccggccaggaccgctcgccacggagcgcccctcgagccggggacagtgcag
gtcgcgccgcccgaccgccacctgctcaccgaagacggaacgctggtcctgacgcaggga
ccgacggagaacgggcatcggccggcggtcaacgcgaccttccggtcggccgcgctgacc
ggcggccagcgcgtcatcggcgtcatcctttcgggcgcgctggacgacggtgccgccggg
ctgcgggcgatcgtggaccggggcggcctggccgtcgtccaggacccggccgacgcgctg
taccgcggcatgccggagagcgcactggccctcgtggacaccgagcacgtggcgcgggtc
gtcgagatcggtgccgtgctcgacaagctggtccggatgccggtggagcccttcgaggta
ccgccgccgtcggacgccctgctgctggaagaccggatcgcccgtgaggcggtgcggctc
ggcgcgctcacggccgccgaacgaagcgtggggtcgggttacacctgcccggattgccag
gggtcgctcaccgaggtcgacccggtgggccgctaccggtgccggatcgggcacgcctgg
tcggctccggccctgctcgaagcccacagccgggagttccagctcgcgctgatgaaggcg
ctgcgcgcgctggacgaaaaggcggcactcgcccggaagctggccgcgcagaccggcacc
acgaggccgagcgggctggcggagcgctatgccgcctccgcccgggaagccaccgacgcc
gccgagaccctgcggcggttcctgctcgacgcggaccgcgaggccgcgggcgacccggcg
tcgggatga

DBGET integrated database retrieval system