KEGG   Amycolatopsis mediterranei U32: AMED_4131Help
Entry
AMED_4131         CDS       T01269                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amd02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4539437..4540465
Genome map
AA seq 342 aa AA seqDB search
MDAVPPFRRDLVVVGASAGGVEALRSLVSGLPADFPAAVLVAMHLGAGTQSALARILDRV
GPLPARTARHGAPLEPGTVQVAPPDRHLLTEDGTLVLTQGPTENGHRPAVNATFRSAALT
GGQRVIGVILSGALDDGAAGLRAIVDRGGLAVVQDPADALYRGMPESALALVDTEHVARV
VEIGAVLDKLVRMPVEPFEVPPPSDALLLEDRIAREAVRLGALTAAERSVGSGYTCPDCQ
GSLTEVDPVGRYRCRIGHAWSAPALLEAHSREFQLALMKALRALDEKAALARKLAAQTGT
TRPSGLAERYAASAREATDAAETLRRFLLDADREAAGDPASG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccgtgccgcctttccggcgtgacctcgtggtcgtcggtgcctccgccggcggg
gtcgaggccttgcggtccctggtgtccgggttgcccgccgatttcccggccgcggttctg
gtcgccatgcacctgggcgccgggacgcagagcgcgctggcccggattctcgaccgcgtg
ggcccgctgccggccaggaccgctcgccacggagcgcccctcgagccggggacagtgcag
gtcgcgccgcccgaccgccacctgctcaccgaagacggaacgctggtcctgacgcaggga
ccgacggagaacgggcatcggccggcggtcaacgcgaccttccggtcggccgcgctgacc
ggcggccagcgcgtcatcggcgtcatcctttcgggcgcgctggacgacggtgccgccggg
ctgcgggcgatcgtggaccggggcggcctggccgtcgtccaggacccggccgacgcgctg
taccgcggcatgccggagagcgcactggccctcgtggacaccgagcacgtggcgcgggtc
gtcgagatcggtgccgtgctcgacaagctggtccggatgccggtggagcccttcgaggta
ccgccgccgtcggacgccctgctgctggaagaccggatcgcccgtgaggcggtgcggctc
ggcgcgctcacggccgccgaacgaagcgtggggtcgggttacacctgcccggattgccag
gggtcgctcaccgaggtcgacccggtgggccgctaccggtgccggatcgggcacgcctgg
tcggctccggccctgctcgaagcccacagccgggagttccagctcgcgctgatgaaggcg
ctgcgcgcgctggacgaaaaggcggcactcgcccggaagctggccgcgcagaccggcacc
acgaggccgagcgggctggcggagcgctatgccgcctccgcccgggaagccaccgacgcc
gccgagaccctgcggcggttcctgctcgacgcggaccgcgaggccgcgggcgacccggcg
tcgggatga

DBGET integrated database retrieval system