KEGG   Amycolatopsis mediterranei U32: AMED_4219Help
Entry
AMED_4219         CDS       T01269                                 

Gene name
mhpF
Definition
(RefSeq) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00360  Phenylalanine metabolism
amd00362  Benzoate degradation
amd00620  Pyruvate metabolism
amd00621  Dioxin degradation
amd00622  Xylene degradation
amd00650  Butanoate metabolism
amd01100  Metabolic pathways
amd01120  Microbial metabolism in diverse environments
amd01220  Degradation of aromatic compounds
Module
amd_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMED_4219 (mhpF)
   00650 Butanoate metabolism
    AMED_4219 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AMED_4219 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMED_4219 (mhpF)
   00622 Xylene degradation
    AMED_4219 (mhpF)
   00621 Dioxin degradation
    AMED_4219 (mhpF)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AMED_4219 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 9438406
NCBI-ProteinID: YP_003766396
UniProt: A0A0H3D8X1
Position
4625556..4626455
Genome map
AA seq 299 aa AA seqDB search
MAPVMAAIVGPGNIGTDLLAKLRRSEVIEVGYVVGVVESDGLERARAQGIAASADGVDWL
LRQDPVPQLVFEATSAKAHAANAPRYAEAGIQAIDLTPAHLGPMVCPPVNLGAHLDAPNV
SMITCGGQATIPMVHAVSRVTAVPYAEIVASVASRGAGPGTRANIDEFTRTTSQAVAEIG
GAGRGKAIIILNPVEPPMIMRDTVFCAIGLDADRDAITASIHEMADEVRKYVPGYSLRAD
PQFDDAREEWDGHARVGIFLEVRGNGDYLPEYAGNLDIMTAAAARVGELMARAKQEVPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgtgatggcggcgatcgtcggccccggcaacatcggcaccgatttgctggcg
aagctgcgacgcagtgaagtgatcgaagtcggttacgtggtcggcgtggtcgagtcggac
ggtctcgagcgcgcccgcgcgcaggggatcgcggcgtccgcggacggcgtcgactggctg
ctgcgccaggatcccgtgccccagctcgtgttcgaagcgacgtcggcgaaggcgcacgcc
gcgaacgcgccgcggtacgccgaagccggcatccaggcgatcgacctgaccccggcgcac
ctcggcccgatggtgtgcccgccggtgaacctcggcgcgcacctcgacgcgccgaacgtt
tcgatgatcacctgcggcggccaggccacgatccccatggtgcacgccgtttcgcgggtg
accgcggtcccgtacgccgagatcgtcgcctcggtcgcttcgcggggagcgggccccggg
acgcgggcgaacatcgacgagttcacgcgcacgacgtcgcaggcggtggccgagatcggc
ggtgccgggcgcggcaaggcgatcatcatcctcaacccggtcgagccgccgatgatcatg
cgggacacggtgttctgcgcgatcggcctcgacgccgaccgcgacgcgatcaccgcgtcg
atccacgagatggccgacgaagtccgcaagtacgtgccggggtattcgctgcgggcggac
ccgcagttcgacgacgcacgcgaggaatgggacgggcacgcgcgggtcggcatcttcctc
gaggtccgcggcaacggcgactacctgcccgagtacgccgggaacctggacatcatgacc
gccgcggccgcccgcgtgggcgagctgatggcccgcgcgaagcaggaggtgccggcatga

DBGET integrated database retrieval system