KEGG   Amycolatopsis mediterranei U32: AMED_4330Help
Entry
AMED_4330         CDS       T01269                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMED_4330 (adh)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AMED_4330 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4733281..4734306
Genome map
AA seq 341 aa AA seqDB search
MKAVRLQKYHQHPVIEDVLQPRATGPFDVVVKIGGAGVCRTDLHIIEEQWAEKSGVELPY
TIGHENAGWVHEVGPAVTNVEVGDTVILHPTPTCGLCHACRTGDDMHCPNGSFPGISSDG
GMAEYLLTSARACIKLDPSTEPSDVAALADAGITAYHAVRKAVPHLYPGTACVVNGAGGL
GHIGIQSLRALTAARVIVVDRNADALELASTLGADFTVLADGKQVEAVLDLTDGNGAEVV
LDFVAEQGAQQDAFAMTRRAGSHFVIGYGSNIEIPTIDIISTERNIIGNLVGTYNDLAEL
MVLAQAGKVTLHTKKYPLDAALDALADLDAGRVRGRAILTP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgcggctgcagaagtaccaccagcacccggtgatcgaagacgtcctccag
ccgcgcgccaccgggccgttcgacgtcgtggtcaagatcggcggtgccggcgtctgccgc
accgacctgcacatcatcgaggagcagtgggccgagaagtccggcgtcgaactgccgtac
acgatcgggcacgagaacgcgggctgggtgcacgaggtcggcccggcggtgacgaacgtc
gaggtcggggacacggtcatcctgcacccgacgccgacgtgcggcctgtgccacgcctgc
cgcacgggcgacgacatgcactgcccgaacgggagcttcccgggcatcagcagcgacggc
gggatggccgaatacctgctgacgtcggcgcgggcgtgcatcaagctcgacccgtcgacc
gagccttccgacgtggcggcgttggctgacgcagggatcaccgcttaccacgcggtgcgc
aaggccgtcccgcacctgtacccgggcaccgcctgcgtcgtcaacggcgccggcggcctc
gggcacatcggcatccagtcgcttcgcgcgttgaccgccgcccgcgtgatcgtggtggac
cgcaacgccgacgccctcgaactggcgtcgaccttgggcgcggatttcacggtgttggcc
gacggcaagcaggtcgaagccgtcctcgacctgaccgacggcaacggcgccgaggtcgtg
ctcgacttcgtcgccgagcagggcgcccagcaggacgccttcgcgatgacccggcgtgcc
gggtcgcacttcgtcatcggctacggctcgaacatcgagatcccgacgatcgacatcatc
tccaccgagcgcaacatcatcggcaacctcgtgggcacctacaacgacctggccgagctg
atggtgctcgcccaagccgggaaggtcacgctccacacgaagaagtacccgctggacgcc
gcgctcgacgcgctggccgacctcgacgccgggcgcgtgcgcggccgggccatcctcacc
ccctag

DBGET integrated database retrieval system