KEGG   Amycolatopsis mediterranei U32: AMED_4414Help
Entry
AMED_4414         CDS       T01269                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMED_4414 (glpK)
Enzymes [BR:amd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AMED_4414 (glpK)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMED_4414 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4838065..4839579
Genome map
AA seq 504 aa AA seqDB search
MPDFVGAVDQGTTSTRFMIFDHGGNEIARHQLEHEQILPKPGWVEHDATEIWERTRSVIA
TALNKANLTVGDLAALGITNQRETTVVWNRRTGRPYHNAIVWQDTRTDRIASALEREGKG
DVIRRKAGLPPATYFSGGKLQWILENVEGVREDAEKGDALFGTTDSWLIWNLTGGPDGGV
HVTDPTNASRTMLMDLETLDWDDELLSFFNVPRRMLPAIRPSSNPGFGTTRADGPLGGEV
AITGVLGDQQAATVGQVCFRPGEAKNTYGTGNFLLLNTGQELVRSKHGLLTTLCYQFGDD
KPVYALEGSIAVTGSAVQWLRDQLGIISGASQSESLARQVEDNGGIYFVPAFSGLFAPYW
RSDARGAIVGLTRATTNAHLARATLEAICYQTRDVVEAMQNDSGVTLDVLRVDGGVTANE
LCMQLQADILGVPVSKPVVAETTALGAAYAAGLAVGFWKSTDELEQNWNEDKRWTPSWSD
EQRAEGYAGWQKAVGRTLDWVDVQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccggacttcgtcggcgccgtagaccagggcaccaccagcacccgcttcatgatcttc
gaccacggcggcaacgagatcgcccgccaccagctcgagcacgagcagatcctgcccaag
ccgggctgggtcgagcacgacgccaccgagatctgggaacgcacccgctcggtcatcgcg
accgcgctcaacaaggcgaacctgaccgtcggcgacctggccgcgctgggcatcaccaac
cagcgcgagaccaccgtcgtgtggaaccgccgcaccggccgcccgtaccacaacgccatc
gtctggcaggacacccgcaccgaccggatcgcctccgcgctcgagcgcgagggcaagggc
gacgtcatccgccgcaaggccggcctgccgcccgccacctacttctccggcggcaagctg
cagtggatcctcgagaacgtcgaaggcgtgcgcgaggacgccgagaagggcgacgccctc
ttcggcaccaccgactcgtggctgatctggaacctcaccggcggcccggacggcggcgtc
cacgtcaccgacccgaccaacgcctcccgcaccatgctgatggacctcgagacgctggac
tgggacgacgaactgctgtcgttcttcaacgtcccgcgccggatgctcccggcgatccgg
ccgtcgtcgaaccccggcttcggcaccacccgcgcggacggcccgctcggcggcgaggtc
gccatcaccggcgtcctcggcgaccagcaggccgccaccgtcgggcaggtctgcttccgg
cccggcgaggccaagaacacctacggcaccggcaacttcctgctgctgaacaccggccag
gagctcgtccgctcgaagcacggcctgctcacgacgctgtgctaccagttcggcgacgac
aagccggtctacgcgctggaaggctcgatcgcggtcaccggttccgcggtgcagtggctg
cgcgaccagctgggcatcatcagcggcgcgtcccagagcgagagtctggcccgccaggtc
gaggacaacggtggcatctacttcgtcccggcgttctccggtctgttcgcgccgtactgg
cgctccgacgcccgcggcgcgatcgtcggcctcacccgcgccaccaccaacgcccacctg
gcgcgggcgaccctggaagcgatctgctaccagacccgcgacgtcgtcgaggcgatgcag
aacgactccggcgtcacgctggacgtgctgcgggtggacggcggcgtcaccgccaacgag
ctgtgcatgcagctgcaggcggacatcctcggcgtgccggtgtcgaagccggtcgtggcc
gagaccaccgcgctcggtgccgcctacgcggccgggctggccgtcggcttctggaagtcg
accgacgagctcgagcagaactggaacgaggacaagcgctggacgccgtcgtggagcgac
gagcagcgcgccgaaggctacgcgggctggcagaaggccgttggccgcacgctcgactgg
gtcgacgtgcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system