KEGG   Amycolatopsis mediterranei U32: AMED_4516Help
Entry
AMED_4516         CDS       T01269                                 

Gene name
desC
Definition
stearoyl-CoA desaturase (delta-9 desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:amd01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:amd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4959822..4960754)
Genome map
AA seq 310 aa AA seqDB search
MTASVKAAPPAPKPVLSGKQTIPELITIRTFLLVPFLALAVAVPVFWGWGVSWLDLTIGG
AFFVVSTLGVTVGYHRYFTHGSFRAKRALRIALAVAGGLAAQGPVIGWVADHRRHHAFSD
REGDPHSPWLFGTSPVALARGFWHAHMGWLFGRDKTNVDRFAPDLAADRDLRVVDRLFPV
WVVVSLLLPPLLGGLITLSWWGALTAFLWAGLARISFQHHVTWSVNSICHMIGERPFTSR
DRSANFWPLAILSMGESWHNTHHADPTSARHGAQRGQIDISARVIWAFEKLGWAWNVRWP
TAKRLAALAR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctccgtgaaggctgccccgccggccccgaaaccggtgctctcgggcaagcag
acgatccccgagctcatcaccatccgcacgttcctgctggtcccgttcctggcgctggcc
gtcgccgtcccggtgttctggggctggggcgtcagctggctggacctcacgatcggcggc
gcgttcttcgtggtctcgaccctcggggtcaccgtcggctaccaccggtacttcacccac
ggctcgttccgcgcgaagcgggccctgcggatcgcgctggccgtcgccggcggcctcgcc
gcacagggcccggtgatcggctgggtcgccgaccaccgacggcaccacgccttttccgac
cgcgagggcgacccgcactcgccgtggctgttcgggacgtccccggtggcgctggcccgc
ggcttctggcacgcgcacatgggctggctcttcggccgcgacaagaccaacgtcgaccgg
ttcgccccggacctggccgccgaccgcgacctgcgcgtcgtcgaccggctcttcccggtg
tgggtggtggtgagcctgctgctcccgccgctgctcggcggcctgatcacgctgtcgtgg
tggggcgcgctgaccgcgttcctctgggccggcctggcccggatctccttccagcaccac
gtgacgtggtcggtgaactcgatctgccacatgatcggcgaacgcccgttcaccagccgc
gaccgctcggcgaacttctggccgctggccatcctgtcgatgggcgagtcctggcacaac
acccaccacgcggacccgacctcggcccgccacggcgcgcagcgcgggcagatcgacatc
tcggcgcgggtgatctgggcgttcgagaagctcggctgggcgtggaacgtccgctggccg
acggcgaagcggctggccgcactggcccgctga

DBGET integrated database retrieval system