KEGG   Amycolatopsis mediterranei U32: AMED_4603Help
Entry
AMED_4603         CDS       T01269                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMED_4603 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMED_4603 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AMED_4603 (thrC)
Enzymes [BR:amd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AMED_4603 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(5066928..5068037)
Genome map
AA seq 369 aa AA seqDB search
MEYWYTDERSGARYPGDPLRWRGDDGAPLTVAARPGLRPEDVDTGVRSLWRYRAALPGDL
RPVSLGEGCTPLVPQVWGDAEVRFKLEWFSPTGSFKDRGTSVMVSALAGAGVRELLEDSS
GNGGSSVAAYSAAAGIAATVLAPAGTSPAKVLQTRAYGAAVELVPGTRDDTAAEAVRRSE
ATTYASHNWHPFFLQGTKTLAYELWEDLGFRAPDAVVTAAGAGSIVLGCDLGFGELLAAG
SIARRPRLLVAQPRNCSPVDAACHDREPPEFAPTIAEGTAIRRPVRLPEVVAAIRRSGGD
TAAITEDAIAAAARRLASLGLYAEPTSATAAAAIDVFRARGAIRPGETTVVVLTGSGLKA
ADKLRELIG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtggagtattggtacaccgacgagcggtcaggggcgcggtaccccggtgatccgctgcgc
tggcgtggtgacgacggtgccccgctcaccgtcgccgcccggcccggcctgcgcccggag
gacgtcgacaccggcgtccgctcgctctggcgctaccgggcggcgctgcccggcgacctc
cgcccggtgtcgctcggggaaggctgcaccccgctcgtcccgcaggtgtggggcgacgcc
gaggtccggttcaagctcgaatggttcagcccgaccggcagcttcaaggaccgcggcacc
agcgtcatggtctccgcgctggccggcgccggggtgcgcgagctgctggaggacagctcc
ggcaacggcggctcgtcggtggcggcctacagcgccgcggctgggatcgcggcgaccgtc
ctcgctccggcggggacgtcgccggcgaaggtgctgcagacccgcgcgtacggcgcggcc
gtcgagctggtgccgggcacccgcgacgacacggccgccgaagccgtccgccgctcggag
gccaccacctacgccagccacaactggcacccgttcttcctgcagggcaccaagaccctg
gcctacgagctgtgggaggacctcgggttccgcgcgccggacgccgtcgtcacggcggcc
ggcgccggcagcatcgtgctgggctgcgatctggggttcggggagctgctggccgccggg
tccatcgcgcggcgcccgcgcctgctcgtcgcccagccgcggaactgctcccccgtcgac
gcggcctgccacgaccgggagccgccggagttcgccccgaccatcgccgaggggacggcg
atccgccgtccggtgcggctgcccgaagtcgtcgcggcgatccggcgctcgggcggggac
accgcggcgatcaccgaagacgccatcgccgcggcggcccgccgcctggcgtccctcggc
ctctacgcggagccgaccagcgcgaccgccgcggcggcgatcgacgtcttccgcgcgcgg
ggtgccatccggcccggcgagaccacggtggtcgtgctcaccggctcgggcctgaaggcg
gctgacaagctgagggagctgatcggatga

DBGET integrated database retrieval system