KEGG   Amycolatopsis mediterranei U32: AMED_4934Help
Entry
AMED_4934         CDS       T01269                                 

Gene name
chlI
Definition
magnesium chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMED_4934 (chlI)
Enzymes [BR:amd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AMED_4934 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5456500..5457897)
Genome map
AA seq 465 aa AA seqDB search
MNAVPDALPRTAGALRAAGFEPRPIAQEIHDNLLSALKNGEDAWPGIVGFSRTVLPQLER
ALLAGHDVVLLGERGQGKTRLLRTLAGLLDEWTPVIEGSELGEHPLQPITPASIRRAAEL
GDDLPVAWRHRSERYTEKLATPDTSVGDLIGDVDPVKVAEGRSLGDPETIHFGLVPRAHR
GIVAINELPDLAERIQVALLNVMEERDIQVRGYTLRLPLDVLLVATANPEDYTNRGRIIT
PLKDRFGAEIRTHYPLDVESEVAVVRQEANLVAEVGEPLLEVLARFVRNLRESTVIDQRS
GVSARFAVAAAETVAAAALRRSALTGEEPAVARPVDLDAVPSVLRGKIEFEPGEEGREIE
HLVHLLRLAIAETARDRFAGLDLRPLADAVGEGHLVSTGERVPGKDVLAALPELPVLHEV
ARRAGVAADEPAGRIAAAVELALESLFLSRRLAKDSDDTTTVYGR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctgttccagacgctcttccccgcaccgccggggccctgcgcgcggccgggttc
gagccgcgccccatcgcgcaagagatccacgacaacctgctgagcgccctcaagaacggc
gaggacgcctggcccggcatcgtcgggttctcccgcaccgtgctgccgcagctcgaacgc
gcgctgctggccggccacgacgtcgtcctgctcggcgaacgcggccagggcaagacccgc
ctgctgcgcaccctcgccggcctgctcgacgagtggacgcccgtcatcgaaggctccgag
ctgggcgaacacccgctgcagccgatcacgcccgcgtcgatccggcgggccgcggagctc
ggcgacgacctgccggtggcctggcgccaccgctccgagcgctacaccgaaaagctcgcc
acgccggacacctccgtcggcgacctgatcggcgacgtcgacccggtgaaggtcgccgaa
ggccgcagcctcggcgaccccgagacgatccacttcgggctggtcccgcgcgcccaccgc
ggcatcgtcgccatcaacgagctgcccgacctggccgaacgcatccaggtcgcgctgctc
aacgtgatggaggagcgcgacatccaggtccgcggctacacgctgcggctgcccttggac
gtcctgctcgtcgccaccgcgaaccccgaggactacaccaaccgcggccggatcatcacc
ccgctgaaggaccgcttcggcgccgagatccgcacccactaccccttggacgtcgagtcc
gaggtggccgtcgtccggcaggaggcgaacctcgtcgccgaagtcggcgagccgctgctg
gaggtgctcgcccggttcgtccggaacctgcgcgaatcgacggtgatcgaccagcgctcc
ggcgtgtcggcccggttcgccgtcgccgcggcggagaccgtggcggccgcggccctgcgg
cgctcggcgttgacgggggaggagcccgcggtggcccgcccggtcgacctcgacgccgtg
ccgtcggtgctgcgcggcaagatcgagttcgagcccggcgaggagggccgcgagatcgag
cacctcgtgcacctgctgcgcctggcgatcgccgaaaccgcgcgcgaccgcttcgccggc
ctcgacctgcggccgctggccgacgcggtcggcgagggccacctggtctccaccggcgag
cgcgtgccgggcaaggacgtcctcgccgccctgccggagctgccggtgctgcacgaggtc
gcccggcgggccggggttgccgccgacgagcccgccggccggatcgcggccgccgtcgaa
ctcgccctcgaatcgctgttcctgtcgcgaaggcttgccaaggactccgacgacacgacg
accgtctacggccgatga

DBGET integrated database retrieval system