KEGG   Amycolatopsis mediterranei U32: AMED_4996Help
Entry
AMED_4996         CDS       T01269                                 

Gene name
acs
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00620  Pyruvate metabolism
amd00640  Propanoate metabolism
amd00680  Methane metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_4996 (acs)
   00620 Pyruvate metabolism
    AMED_4996 (acs)
   00640 Propanoate metabolism
    AMED_4996 (acs)
  Energy metabolism
   00680 Methane metabolism
    AMED_4996 (acs)
Enzymes [BR:amd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AMED_4996 (acs)
Lipid biosynthesis proteins [BR:amd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AMED_4996 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 9439174
NCBI-ProteinID: YP_003767164
UniProt: A0A0H3D910
Position
complement(5519787..5521490)
Genome map
AA seq 567 aa AA seqDB search
MSASEVHHAFRVARDYLLTHREDYDTAYRDFAWPEFDEFNWAIDWFDVVAHDPDNAERYA
LWIVEEDGTENRWTYPELSGRSNQVANWLRNLGVRRGDRLILMLGNQGELWETILAAIKL
GAVIIPASTLLGPADLADRVERGAAKHVVVRSVDAPKFDGVTGDYTRIVVGEPVDGWHSY
SAAFAESPEYAPDGPTQAGDPLLLYFTSGTTAKPKLVQHTHVSYPVGHLSTMYWIGLEPG
DVHLNISSPGWAKHAWSNFFAPFNAEATVFLYNYGRFDAGALMAQMDRCGVTSFCAPPTV
WRMLIQADLTALGTRPRKVVGAGEPLNPEVIEQVRKSWGVTIRDGFGQTESSVQIANTPG
QDVVPGSMGRPLPGFVVALVDPVSGERATEGEICLDLAHRPVGLMTGYADDDERTSAAFG
GGFYHTGDVASVDERGYLTYVGRTDDVFKASDYRISPFELESVLIEHEAVAEAAVVPAPD
PIRLAVPKAYVVLAVGFSADAETARSILAYCREHLAPYKRIRRLEFAELPKTISGKIRRV
ELRGRESDPKRGQGTEYREEDFPDLKS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcttcggaggtccaccacgcgttccgcgtcgcgcgggactacctgttgacccac
cgcgaggactacgacacggcgtaccgcgacttcgcctggccggagttcgacgagttcaac
tgggcgatcgactggttcgacgtcgtcgcgcacgacccggacaacgccgagcggtacgcg
ctgtggatcgtcgaggaggacggcaccgagaaccgctggacctacccggagctgtccggc
cggtccaaccaggtggcgaactggctgcggaacctcggcgtccgccgcggcgaccggctg
atcctcatgctgggcaaccagggcgagctgtgggagacgatcctcgccgcgatcaagctc
ggcgcggtgatcatcccggcctccaccctgctcgggccggccgacctggccgaccgggtg
gagcgcggcgccgccaagcacgtcgtcgtccgctcggtggacgcgccgaagttcgacggc
gtgaccggcgactacacccggatcgtggtgggggagccggtcgacggctggcactcgtac
tcggcggcgttcgccgagtcgccggaatacgccccggacggccccacgcaggccggcgac
ccgctgctgctgtacttcacctccggcacgaccgcgaagccgaagctggtgcagcacacg
cacgtctcgtaccccgtgggccacctgtccacgatgtactggatcgggctggagcccggc
gacgtccacttgaacatctcctcgccgggctgggcgaagcacgcgtggagcaacttcttc
gcgccgttcaacgccgaggcgacggtgttcctctacaactacggccggttcgacgcgggc
gccctgatggcgcagatggaccgctgcggcgtgacgagcttctgcgcgccgccgacggtg
tggcggatgctcatccaggccgatctgacggcgctcggcacacggccgcgcaaggtcgtc
ggggcgggggagccgctcaaccccgaggtgatcgagcaggtccggaagtcgtggggcgtc
accatccgcgacggcttcggccagaccgaaagcagcgttcagatcgcgaacacgccgggc
caggacgtcgtgcccggttcgatgggccgcccgctgcccggcttcgtggtggcgctggtg
gacccggtcagcggcgagcgcgccacggagggcgagatctgcctggacctcgcccaccgg
ccggtgggcctgatgaccgggtacgcggacgacgacgagcgcacgtcggcggccttcggc
ggcggcttctaccacaccggtgacgtcgcttcggtcgacgaacgcggctacctcacctac
gtcgggcgcaccgacgacgtgttcaaggcgtcggactaccgcatctcgccgttcgaactg
gagagcgtcctcatcgagcacgaggcggtggccgaggcggcggtcgtcccggcccccgac
ccgatccggctcgcggtgcccaaggcctacgtcgtgctggccgtggggttctccgcggac
gccgagaccgcgcggtcgatcctggcgtactgccgggagcacctggcgccgtacaagcgg
atccgccggctggagttcgcggagctgccgaagacgatctcgggcaagatccgccgcgtc
gagctgcggggccgcgagagcgacccgaagcgcggccaggggaccgagtaccgcgaagag
gacttcccggacctcaagtcctga

DBGET integrated database retrieval system