KEGG   Amycolatopsis mediterranei U32: AMED_4997Help
Entry
AMED_4997         CDS       T01269                                 

Gene name
paaG
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:amd01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:amd00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:amd00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:amd00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:amd00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:amd00310]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:amd00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:amd00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:amd00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:amd00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:amd00281]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:amd00362]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:amd00627]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:amd00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5521504..5522346)
Genome map
AA seq 280 aa AA seqDB search
MTATADSLPDLVSLKVDVDGHVAEVTLLGPSKGNAMGPDFWRELPLVFRALDADPQVRAV
VLTGSGKHFSYGLDLPAMMGDWAPMLGGDSLAGPRTAFLDQVRSLQAAVGSIAECRKPVV
AAVSGWCIGGGVDVVAAADVRLASADAKFSVREVRVAIVADLGSLQRLASIIGEGHLREL
ALTGKDVDAARAEKIGLVNDVYEDQDAVLKAARELAGEIAANPPLVVQGTKQVLAANTER
QVADGLRYVAAWNSAFLPSKDLGEAVQAFMERRAPEFKGE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctactgctgacagtctgcccgacctggtctccttgaaggtcgacgtcgacggc
cacgtggccgaagtgacgcttctcggcccgtcgaagggcaacgcgatgggcccggacttc
tggcgcgagctgcccctggtgttccgcgcgctggacgccgacccgcaggtcagggccgtg
gtgctcaccggcagcggcaagcacttctcctacggtctcgacctgccggcgatgatgggc
gactgggcgccgatgctgggcggggacagcctggccggcccgcgcacggcgttcctcgac
caggtccggtcgctgcaggcggcggtcggctcgatcgcggaatgccgcaaaccggtcgtc
gcggccgtctcgggctggtgcatcggcggcggggtcgacgtcgtcgcggccgccgacgtc
cggctggccagcgccgacgccaagttcagcgtccgcgaggtgcgcgtggccatcgtcgcc
gacctcggcagcctgcagcggctcgcctcgatcatcggtgaggggcacctgcgggagctc
gccctcaccggcaaggacgtcgacgccgcccgcgccgagaagatcggcctggtcaacgac
gtctacgaggaccaggacgcggtgctgaaggccgcgcgcgaactcgccggcgagatcgct
gcgaacccgccgctggtggtgcaaggtacgaagcaggtactggcggcgaacaccgagcgc
caggtcgccgacggcctccggtacgtcgccgcctggaactcggcgttcctgcccagcaag
gacctcggcgaagcggtccaggcgttcatggaacggcgcgcgccggagttcaagggcgaa
taa

DBGET integrated database retrieval system