KEGG   Amycolatopsis mediterranei U32: AMED_5066Help
Entry
AMED_5066         CDS       T01269                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:amd00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:amd00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5617303..5618901)
Genome map
AA seq 532 aa AA seqDB search
MVVIAIVALALGGHAGAARGDAGRTAPPVTGMNALVPQPVAVQQATGTGYAITASTTILV
EPGSAPVEEIGVELARVLRRSTGYALPVVAAPGREAATADGISLLLSGAGAELGDEGYLL
DVSAGGVVVRANQPEGLFNGVQTLRQLLPAAADSATIQPGPWPVPAGHIEDHPRFPYRGA
MLDVARHFFPVATVERYLDEISRYKVNRLHLHLADDQGWRIAITSWPQLATVGGSTAVGG
GPGGYYTQADYRAIVDYARAHYVTIVPEIDGPGHTNAALASYPALNCTGTAPPLYTGTDV
GFSSLCVGKDITYTFLDNVLGELAGLTPGPYLHIGGDEAQSTKAKDYTSFEGKELPLVAG
YGKAPMAWHDIAAVTPPASTVLEYWGTTTSEPKTAAAVARGNKVVLAPANKAYLDMKYSR
KTKLGQNWAGYIEEQTAYDWNPGSYLSGVGESAVLGVEAPLWSETLVTLADLEFMTFPRL
PAIAELGWSPAATHDWTSFRSRLGAQGPRWTVLGIGFFASAQIPWAPGTRAG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtgatcgcgatcgtggcgctcgccctgggcggccacgccggtgcggcccggggc
gatgccggccggacagcgccgcccgtgaccggcatgaacgccctcgtgccgcaaccggtc
gccgttcagcaggccaccggaaccggctacgcgatcacggcgagcacgaccatcctggtc
gagcccgggtcggcgcccgtcgaagagatcggcgtcgagctcgcgagggttctccgccgc
tcgacgggctacgcgctaccggtggtggccgcccccggccgggaagcggccaccgccgac
gggatctcgctgctgttgtccggtgcgggcgccgaactcggcgacgagggctacctgctg
gacgtgagcgcgggcggcgtcgtcgtccgcgcgaaccagccggaaggcctgttcaacggg
gtgcagacgctgcgccagctgctgccggcggccgcggacagcgccaccatccaacccgga
ccgtggccggtgcccgccgggcacatcgaggatcacccgcgcttcccctaccgcggcgcg
atgctcgacgtggcccgccacttcttcccggtcgccaccgtggagcgctacctcgacgag
atctcccggtacaaggtgaaccgcctgcacctgcatctggccgacgatcaaggctggcgc
atcgcgatcaccagctggccacagctggcgaccgtcggcggcagcaccgcggtcggcggg
ggccccggcggctactacacccaggccgactaccgcgcgatcgtggactacgcgcgggcg
cactacgtcacgatcgtgccggagatcgacggcccggggcacaccaacgccgccctcgcc
tcgtatccggcgctcaactgcacgggaacggcgccaccgctctacaccggcacggatgtc
ggattcagctcgctgtgcgtcggcaaggacatcacctacaccttcctcgacaacgtgctc
ggcgagctcgccgggctcacccccggcccctatctgcacatcggcggcgacgaggctcaa
tccaccaaggcgaaggactacacgagcttcgaaggcaaggaactgccgctcgtggccggg
tacggcaaggcgcccatggcctggcacgacatcgccgccgtcaccccgccggcctcgacc
gtgctggagtactggggaacgacgacgtccgagccgaagaccgcggccgcggtggcgcgg
gggaacaaggtggtgctggccccggcgaacaaggcgtacctggacatgaagtacagccgc
aagaccaagctcgggcagaactgggccggctacatcgaggagcagacggcctacgactgg
aacccagggtcctatctcagtggcgtcggggagtcggcggtgctgggcgtggaagcgccg
ctgtggtcggaaaccctggtcaccctcgccgacctcgagttcatgaccttcccgaggctg
ccggccatcgccgaactgggctggtcaccggcggcgacgcacgactggacgtcgttccgg
tcccgcctcggcgcacaggggccgcgctggacggtgctggggatcggcttcttcgcctcg
gcgcagatcccctgggccccgggaacccgcgccggctga

DBGET integrated database retrieval system