KEGG   Amycolatopsis mediterranei U32: AMED_5192Help
Entry
AMED_5192         CDS       T01269                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMED_5192
Enzymes [BR:amd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AMED_5192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5760536..5762065)
Genome map
AA seq 509 aa AA seqDB search
MKRLLSLVVAALVGGAVLTASPAAAAPGTTAAAGTGTGFWHAAGSQLVDATGTPVRMTGI
NWFGAETGNYSPHGLWSRNYKDMLDQMAGLGYNTLRLPYSNQLFDAGSKPVSIDAVQNPD
LQGLSGLQVLDKIVAYAGVKGMRVLLDRHRPDSGAQSPLWYTSAYSESRWISDWTMLAQH
YKGNPTVIGADLHNEPHSIQGGGGACWGCGDTATDWRLAAERAGNAVLAANPDWLIVVEG
VDCVSGTGDPQCGWWGGNLSGARQFPVRLSKPDKLVYSAHEYATSVFAQTWFSDPAFPAN
LPALWDHFFGYLQKQNIAPVLLGEFGSTLADPRDKVWLQELMKYAGSGPSGMSFTYWSWN
PNSGDTGGILNDDWTTVNQTKQAILQPYLIPPVGSGGGTTDPPPAASCAVTYHVDNTWQG
GFIATVTLKNTGSSALKNWALGWTVPSGTQITGGWNATVTQTGQQASAKAPTWAPDLAGG
ATAAIGIQATGASTGSPGGFAVGATACTT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgactgctctcgctggtggtcgccgcactggtcgggggcgccgttctcacggcg
tccccggccgccgcggccccgggcaccaccgcggcggccggcaccgggaccgggttctgg
cacgccgccggctcccagctggtcgacgcgaccggcacgccggtccggatgaccgggatc
aactggttcggcgccgagaccggcaactactcgccgcacgggctgtggagccgcaattac
aaggacatgctcgaccagatggccgggctcgggtacaacacgctgcggctgccgtactcg
aaccagctgttcgacgccgggtccaagccggtcagcatcgacgccgtgcagaacccggac
ctgcagggcctgtccggcctgcaggtgctcgacaagatcgtcgcctacgccggtgtcaag
ggcatgcgcgtgctgctggaccggcaccggccggactccggcgcgcagtccccgctctgg
tacaccagcgcgtactccgaaagccgctggatctccgactggacgatgctggcccagcac
tacaagggcaacccgacggtgatcggcgcggacctgcacaacgagccgcactcgatccag
ggtggcggcggggcctgctggggctgcggcgacaccgcgaccgactggcggctcgccgcc
gaacgggccggcaacgcggtgctcgcggcgaacccggactggctgatcgtcgtcgaaggc
gtcgactgcgtcagcggcaccggcgacccgcagtgcggctggtggggcggcaacctctcc
ggagcccggcagttcccggtgcgactgtccaaaccggacaaactggtgtactcggcgcac
gagtacgcgacgtcggtgttcgcccagacctggttctccgacccggcgttcccggcgaac
ctgcccgcgctgtgggaccacttcttcggctacctgcagaagcagaacatcgcaccggtg
ctgctcggcgagttcggcagcacgctcgccgacccgcgcgacaaggtctggctgcaggag
ctgatgaagtacgcgggcagcggcccgtccgggatgagcttcacgtactggtcgtggaac
ccgaactcgggggacaccggcggcatcctcaacgacgactggaccacggtcaaccagacc
aagcaggcgatcctgcagccctacctgatcccgccggtgggttcgggcggcggcacgacc
gacccgccgcccgcggcgagctgcgcggtcacctaccacgtcgacaacacctggcaaggc
ggcttcatcgccacggtgacgttgaagaacaccggcagctcggcgctgaagaactgggcg
ctcggctggaccgtgccgtccgggacgcagatcaccggcggctggaacgcgaccgtcacg
cagaccgggcagcaggcgagcgccaaggcgcccacctgggcgcccgacctggccggcggg
gccaccgcggcgatcggcatccaggcaaccggcgcctcgaccggctcgcccggcggcttc
gccgtcggcgcgaccgcctgcaccacctga

DBGET integrated database retrieval system