KEGG   Amycolatopsis mediterranei U32: AMED_5300Help
Entry
AMED_5300         CDS       T01269                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5877810..5878406)
Genome map
AA seq 198 aa AA seqDB search
MISSVRGEVLIVGLDHVVVEVGGVGFAVQATPATLATLRRGEEARLHTALVVREDSLTLF
GFADADARELFGLLQTVSGIGPRLALATLAVLDPGKLRAALVEGNITVLTSVPGIGRKGA
ERLTLELRDKVTALAGTGDVPAVTAPGALRAEVVEALAGLGFPAKQAEQAVDKVLADGDG
HTTAGVLRAALATLGRKR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgtcggtacgcggagaagtcctcatcgtcggcctcgaccacgtcgtggtcgag
gtcggcggggtcggcttcgccgtgcaggccaccccggcgacgctggcgaccctgcgccgc
ggcgaagaggcccggttgcacaccgcgctggtcgtccgcgaggactcgctgacgttgttc
ggcttcgccgacgccgacgcgcgcgagctgttcgggctgctgcagacggtgtccgggatc
gggccgcggctcgcgctggccacccttgccgtgctcgaccccggcaagctgcgggccgcg
ctggtcgaaggcaacatcaccgtgctgacctcggtgccgggcatcggccgcaagggcgcc
gaacggctcaccctcgaactgcgcgacaaggtcaccgcgctcgccggcaccggcgacgtg
ccggccgtcaccgcccccggcgccctgcgtgccgaggtcgtcgaggcgctggccgggctc
gggttcccggccaagcaggccgagcaggccgtggacaaggtcctggccgacggcgacggc
cacaccacggccggcgtgctgcgcgccgcgctggccaccctcggccgcaagcggtag

DBGET integrated database retrieval system