KEGG   Amycolatopsis mediterranei U32: AMED_5340Help
Entry
AMED_5340         CDS       T01269                                 

Gene name
acs
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00620  Pyruvate metabolism
amd00640  Propanoate metabolism
amd00680  Methane metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_5340 (acs)
   00620 Pyruvate metabolism
    AMED_5340 (acs)
   00640 Propanoate metabolism
    AMED_5340 (acs)
  Energy metabolism
   00680 Methane metabolism
    AMED_5340 (acs)
Enzymes [BR:amd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AMED_5340 (acs)
Lipid biosynthesis proteins [BR:amd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AMED_5340 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 9439519
NCBI-ProteinID: YP_003767503
UniProt: A0A0H3D8X9
Position
complement(5919383..5920981)
Genome map
AA seq 532 aa AA seqDB search
MSAADRVAELTAEFGAPVLDVAWLLCDRHAGDRVAFTVVDGEPSTLSYGELAARSHRYAR
ALQELGVGPGDRVATLMGKSTDLVTLILAIWRLGAVYVPLFTAFAPQAIALRLDGSGAHV
VVVDADQRHKLDPGPDLPHDPRRHVVTGASLADLAAATSPEPVPRVTTSGDGPLVHMFTS
GTTGKPKGVIHPVSYIAGWQSYLEYALGVTPDSSYWCAADPGWAYGLYSAIVAPLAAGIP
SLLLAGGFSVETTWRTLVEHAVTDFTAAPTVYRGLRSSSVPVPPGLSLQRASSAGEPLTP
EVNDWAGAALGLAVHDHFGQTEVGMPLANHHHPELARPLKAGSMGRPVPGWSVTVLADDK
DEPVEPGVLGRVAIDVAASPLMTFRGYQLPGQSDAKFTADGRWYLTGDAGRFDADGEFFF
SSRDDDVIIMAGYRIGPFEIESVLAQHPAVAECSVIGAPDDVRGEVIEAYVVLRGGHDAS
TALAAELQQFVKTRYAAHAHPRTVHFIDALPKTPSGKTQRYLLRRRRAELTR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcggaccgggtcgccgagctgaccgcggaattcggcgcacccgttctcgac
gtggcgtggctgctgtgcgaccggcacgcgggcgaccgtgtcgcgttcaccgtcgtcgac
ggcgagccttccacgttgtcctacggagagctggccgcacgctcacaccgctacgcacgg
gcgttgcaagagctcggcgtcggtcccggcgaccgggtcgcgaccctgatgggcaagagc
accgacctggtcaccctgatcctcgcgatctggcggctcggcgcggtctacgtcccgctg
ttcaccgcgttcgcgccccaggccatcgccctgcggctggacggatccggcgcgcacgtc
gtggtcgtcgacgccgaccagcggcacaaactcgacccgggtcccgacctgccgcacgac
ccccggcgccacgtcgtcaccggcgcgtcgctggcggacctggccgccgccacctcaccg
gagccggtgccccgggtcaccacgagcggggacggcccgctggtgcacatgttcacctcc
ggtaccaccggcaagcccaagggggtgatccaccccgtctcctacatcgccggctggcag
agctacctggagtacgccctgggtgtcaccccggacagcagctactggtgcgccgccgat
cccggctgggcctacgggttgtactccgcgatcgtcgctccactggccgccggcatcccg
agcctgctgctggcgggtgggttctccgtcgagacgacctggcgcacgctcgtcgagcac
gcggtcaccgatttcaccgccgcgccgacggtgtaccgggggctgcgctcctcgtcggtg
cccgtgccaccggggttgagcctgcaacgggcgtccagcgcgggggagccgctgactccc
gaggtcaacgactgggcgggcgccgcgctcggcctcgccgtgcacgaccacttcggccag
accgaggtcggcatgccactggccaaccaccaccatccggaactggcccgtcccctcaag
gccgggtcgatgggccggccggtgcccggctggagcgtgaccgtcctcgccgacgacaag
gacgagcccgtcgaaccgggcgtgctcggccgggtcgccatcgacgtcgccgcgagcccg
ctgatgaccttccgcggctaccagctccccgggcagagcgacgccaagttcaccgccgac
gggcggtggtacctcaccggcgacgccgggcggttcgacgccgacggcgagttcttcttc
tcttcgcgtgacgacgacgtcatcatcatggccgggtaccgcatcgggccgttcgaaatc
gagagcgtcctcgcccagcaccccgccgtcgccgagtgcagcgtcatcggcgcacccgac
gacgtccgcggggaggtcatcgaggcctacgtcgtcctccgcggcggccacgacgcctcg
acggcactcgccgccgaacttcagcagttcgtcaagacccgctacgccgcccacgcccac
ccgcgcaccgtccacttcatcgacgccctgcccaagacacccagtggcaagacccagcgt
tacctcttgcgccgacggcgagcggaactgacacggtga

DBGET integrated database retrieval system