KEGG   Amycolatopsis mediterranei U32: AMED_5477Help
Entry
AMED_5477         CDS       T01269                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMED_5477
Enzymes [BR:amd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     AMED_5477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6082149..6084494)
Genome map
AA seq 781 aa AA seqDB search
MTALDARPVVLGSTELAQVDALWRAANYLSAGQIYLMANPLLREALRPEQIKPRLLGHWG
TSPGLNFVYAHLNRAILTHDLNAMLVTGPGHGGPALLANTWLEGSYTEAWPDVTRDAAGM
AELFRQFSFPGGVPSHVAPQVPGSIHEGGESGYSLAHAFGAAFDNPGLLVACVVGDGEAE
TGPLATSWHANKFLDPVRDGAVLPILHLNGYKIANPTVLSRIAPAELDALLRGYGYAPIY
VEGYDRELMHQAMAAALDSAVATLAERRGVWPMIVLRSPKGWTGPSVVDGKPVEGTWRAH
QVPLAEVRTNPDHLRQLEEWLRSYRPEELFDSRGRPVADVTTMIPAGERRMGANPHANGG
VLLRPLTLPDIAAHAVAVPRPGATMAEPTRVLGRFLRDVFALNADRANFRLFGPDETASN
RLDAVYDVTGKQWQAAVEPVDEHLSADGRVLEVLSEHLCQGWLEGYLLSGRHGLFSCYEA
FVHIVDSMVNQHIKWLRVHRRIPWRRPVASLNYLLTSHVWRQDHNGFSHQDPGFVDHVAN
KSSEVVRIYFPPDTNTLLEVAAHCLRSRDYVNVVVAGKNDTPNWLDAEQAALHCSRGVSI
WEWASTHTGREPDVVLGCAGDAPTLEVLAAAKILREELPELAVRVVNVVDLMRLQPEAEH
PHGLSDREFDALFTPDRPVIFAYHGYPWLIHRLAYRRTNHHDLHVRGYTEHGTTTTPFDM
LVLNHMDRFQLVIDVIDRVPGLVATAGVLRQRMTEAQGRHGRWIRAHGEDLPEIRDWTWE
G
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgctcgacgcccggcccgtggtgctcggcagcaccgagctggcccaggtggat
gcgctctggcgggccgcgaactacctctcggccggccagatctacctgatggcgaacccg
ctgctgcgcgaggcgctgcgacccgagcagatcaagccgaggttgctcgggcactggggg
acttcacccggcctcaacttcgtctacgcgcatctgaatcgcgcgatcctcacccacgac
ctgaacgccatgctcgtcaccggaccgggtcacggcggcccggccctgctggccaatacg
tggctcgaaggcagctacaccgaggcgtggcccgacgtcacgcgcgacgccgccgggatg
gccgagctgttcaggcagttctccttccccggcggtgtgccgagtcatgtggcgccgcag
gtgcccggctcgatccacgaaggcggggagtcgggttactcgctcgcgcacgccttcggt
gctgcgttcgacaaccccggcctgctggtggcgtgcgtggtcggtgacggcgaggccgag
accgggccgctggcgacgtcctggcacgcaaacaagttcctcgacccggtccgcgacggt
gcggtgctgccgatcctgcacctcaacggctacaagatcgccaacccgaccgtgctctcg
cgcatcgccccggccgagctggacgccctgctgcgcgggtacggctacgcgccgatctat
gtcgagggctacgatcgggagttgatgcaccaggcgatggctgcggcgctcgactcggcg
gtcgccacgctcgccgagcggcgtggcgtgtggccgatgatcgtgctgcgcagccccaag
ggctggaccggtccgtccgttgtggacggaaagccggtggagggcacgtggcgtgcgcac
caggtgccgctggccgaagtccggacgaacccggaccacctgcgccagctggaggagtgg
ctgcgctcgtaccgtccggaggagttgttcgactcccgcggccgtccggtcgcggacgtc
acgacgatgatcccggccggggagcgccggatgggcgcgaacccgcacgccaacggcggc
gtgctgctgcgcccgctgaccctgccggacatcgcggcccacgccgtcgccgtgccgaga
ccgggcgcgacgatggccgagccgacccgggtgctgggccggttcctgcgggacgtcttc
gcgctcaacgccgaccgggcgaacttccgcctgttcggccccgacgagacggcgtccaac
cggctggatgcggtctacgacgtcaccggcaagcaatggcaggcggcggtcgagccggtc
gacgagcacctgtccgccgacggccgcgtgctcgaggtgctctcggagcacctgtgccag
ggctggctcgagggctacctgctgtccggccggcacgggctgttctcgtgctacgaagct
ttcgtccacatcgtcgactcgatggtcaaccagcacatcaagtggctgcgggtgcaccgg
cggatcccgtggcggcgcccggtggcgtcgctgaactacctgctgacttcgcacgtgtgg
cgccaagaccacaacggcttctcccaccaggatcccggcttcgtcgaccacgtcgcgaac
aagagctccgaggtcgtgcggatctacttcccgccggacaccaacaccctgctggaagtc
gccgcgcactgcctgcgcagccgggactacgtgaacgtcgtggttgcgggcaagaacgac
acgccgaactggctggacgccgagcaggcggcgttgcactgctcccgcggcgtgagcatc
tgggagtgggccagcacgcacaccggccgcgaaccggacgtggtcctcggctgcgccggt
gacgctcccacgttggaggtgctggccgcggcgaagatcctgcgggaggaactgccggag
ctggcggtgcgggtggtgaacgtggtcgatctgatgcggctgcagccggaggccgagcac
ccgcacgggctgtcggaccgggagttcgacgcgttgttcacgccggaccggccggtgatc
ttcgcctaccacggctatccgtggctgatccaccggctggcgtaccgccggaccaatcac
cacgacctccacgtgcgcggttacaccgagcacgggacgacgaccacgccgttcgacatg
ctggtgctcaaccacatggaccgcttccagctggtcatcgacgtgatcgaccgggtgccg
ggcctcgtcgcgacggccggggtgctgcggcagcggatgaccgaggcccagggacggcac
gggcggtggatccgggcccacggcgaggatctgcccgagatccgcgactggacctgggaa
ggctga

DBGET integrated database retrieval system