KEGG   Amycolatopsis mediterranei U32: AMED_5583Help
Entry
AMED_5583         CDS       T01269                                 

Definition
stearoyl/acyl-CoA desaturase (delta-9 desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AMED_5583
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AMED_5583
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AMED_5583
Lipid biosynthesis proteins [BR:amd01004]
 Desaturase
  First
   AMED_5583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6188418..6188846)
Genome map
AA seq 142 aa AA seqDB search
MGALTAFFWAGLVRVAVLHHVTWSVNSLCHLIGERPYAARDKSANLWPLAIASMGESWHN
CHHADPTGARHGVRRGRLDVSARLIWLFEKLGWATDVRWPRAEHLARKLNPGYTAAPRGF
GRPARGLFTETPARRPGDGSRS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcgctgaccgcgttcttctgggccggcctggtgcgggtggcggtgctgcaccac
gtcacctggtcggtgaactccctgtgccacctgatcggcgaacggccctacgccgcccgc
gacaagtccgcgaacctctggccgctggccatcgcctcgatgggcgagtcctggcacaac
tgccaccacgccgaccccaccggcgcccgccacggcgtccgccgcggccggctcgacgtg
tccgcgcggctgatctggctgttcgagaagctcggctgggccaccgacgtccgctggccg
agggccgaacacctggcccgcaagctcaaccccggttacaccgcggccccccgcgggttc
ggcaggccggcgcgcggattgttcaccgagacgccggcacgccggcccggcgacgggagc
cggtcatga

DBGET integrated database retrieval system