KEGG   Amycolatopsis mediterranei U32: AMED_5954Help
Entry
AMED_5954         CDS       T01269                                 

Gene name
bdh
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00072  Synthesis and degradation of ketone bodies
amd00650  Butanoate metabolism
amd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AMED_5954 (bdh)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AMED_5954 (bdh)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     AMED_5954 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 KR 3Beta_HSD ADH_zinc_N NAD_binding_7 TrkA_N Methyltransf_24 AdoHcyase_NAD GDP_Man_Dehyd UDPG_MGDP_dh_N Polysacc_synt_2 NAD_binding_3 Methyltransf_11 AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 9440114
NCBI-ProteinID: YP_003768097
UniProt: A0A0H3D9J8
Position
complement(6594467..6595216)
Genome map
AA seq 249 aa AA seqDB search
MTSDLDGRTALVTGGASGIGLACVRALAAAGAKVHVVDIDEHRTEAVASEVGGWAHVADL
TDPTSIDALPAEVDVLVNNAGIQHVAPLEDFPPEVFTRIQALMVTAPFLLIRHTLPAMYA
RGWGRIVNMSSVHGLRASAFKAAYVAAKHGLEGLSKVAALEGAEHGVTSNCVNPGYVRTP
LVDGQIDAQAAEHDIPREDVVAEVLLKRAAIKKLIEPEDVASLVVWLCSPHAGHITGASI
PLDGGWTAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgatctggacgggcgcaccgccctcgtcaccggcggtgcgagcggcatcggc
ctcgcctgcgtccgcgctctcgccgcggccggggcgaaggtgcacgtcgtcgacatcgac
gaacaccgcaccgaggccgtcgcctccgaggtgggcggctgggcgcacgtcgccgacctc
accgaccccacctcgatcgatgccctgcccgccgaagtcgacgtcctggtcaacaacgcc
gggatccagcacgtcgcgcccctcgaagacttcccgcccgaggtcttcacgcggatccag
gccctgatggtcaccgctcctttcctgctcatccggcacaccctccccgcgatgtacgcc
cgggggtggggccggatcgtcaacatgtcgagcgtccacgggctgcgcgcctccgccttc
aaagccgcttacgtcgctgccaaacacggcctagaaggcctgtcgaaggtcgccgccctg
gaaggcgccgaacacggcgtcacgagcaattgcgtgaaccccgggtacgtccgcactccg
ctggtcgacgggcagatcgacgcccaggccgccgagcacgacatcccgcgtgaggacgtc
gtcgccgaggtcctcctcaagcgggccgcgatcaagaagctcatcgaacccgaggacgtc
gcttccctggtggtgtggctgtgctccccgcacgccggccacatcaccggggcctccatc
ccgctcgacggcggttggaccgccgcttaa

DBGET integrated database retrieval system