KEGG   Amycolatopsis mediterranei U32: AMED_6432Help
Entry
AMED_6432         CDS       T01269                                 

Gene name
xynA
Definition
glycosyl hydrolase/beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amd  Amycolatopsis mediterranei U32
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7109030..7110487)
Genome map
AA seq 485 aa AA seqDB search
MRPFTRKPRRSPRSRRGALVVAIGLAPVFAAVAAPPADAASTLRSLAEAQNRYIGTEITG
NMVNNATITSLAGTQFDMVTPGNEMKWDTTEPGNGSYNFGPGDNVVSFAQAHNMRVRGHN
LVWHAQLPGWVNSLPRNQVQGAMEAHITTEVNHYKGKIYAWDVINEPFNEDGSLRQDAFT
NAMGTGYLADAIRTAHNADPNAVLYINDYNIEGENAKSNGLYSLAQSLLSQGVPLGGIGL
ESHFIVGQVPSSMLANMQRFAALGLDVAVTELDDRIQLPASGSSLQQQANDYATVVKDCL
AVTRCPGVSQWGVGDADSWIPGTFPGYGAASMYDNNYQPKPAYNATATALGGPPATSGGP
VHAVGAGKCLDVPNSTTTAGTQVQIRDCSGGSNQTFTHSSSGALSVYNGGDCLDASSRGT
SAGTKVIIWPCNGQANQQWTVNADGTVTGAQSRLCLDVTGGSTANGALVELWTCTGRSNQ
QWTLG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccttcacccgcaagccgcgtcggtcgccgcgctcccggcgcggtgcgctcgtt
gtcgcgatagggctcgcgccggtcttcgccgcggtcgcggcaccgcccgcggatgcggcg
tcgacgctgcgttcgctggccgaggcccagaaccggtacatcggcaccgaaatcaccggc
aacatggtgaacaacgcgacgatcacctcgctcgccggcacccagttcgacatggtcacc
cccggcaacgagatgaagtgggacaccaccgagcccggcaacggttcgtacaacttcggt
cccggcgacaacgtcgtgtccttcgcgcaggcgcacaacatgcgcgtgcgcggccacaac
ctggtctggcacgcccagctccccgggtgggtgaacagcctgccgcgcaaccaggtccag
ggcgcgatggaagcgcacatcaccaccgaggtgaaccactacaagggcaagatctacgcc
tgggacgtgatcaacgaacccttcaacgaggacggcagcctgcgtcaggacgccttcacc
aacgccatgggcaccggctacctcgccgacgcgatccgcaccgcgcacaacgcggacccg
aacgccgtgctgtacatcaacgactacaacatcgaaggcgagaacgcgaagagcaacggt
ctctacagtctcgcgcaatccctgctgtcccaaggcgtgccgctcggcgggatcggcctg
gaaagccacttcatcgtcggccaggtcccgtcgtccatgctcgcgaacatgcagcgcttc
gcggcactcgggctggacgtcgccgtcaccgagctcgacgaccgcatccagctgccggcc
tccggtagcagcctgcagcagcaggccaacgactacgccaccgtggtgaaggactgcctg
gcggtcacccgctgcccgggcgtctcgcagtggggcgtcggcgacgccgattcctggatt
cccgggaccttccccggctacggcgccgcgagcatgtacgacaacaactaccagcccaag
cccgcctacaacgccaccgcgacggcgctgggcggcccgcctgccaccagcggcggaccg
gtgcacgcggtgggcgcgggcaagtgcctggacgtgcccaactcgaccaccacggccggc
acacaggtgcagatccgggactgctcgggcgggtcgaaccagaccttcacccacagctcc
tcgggcgcgctcagcgtgtacaacggcggcgactgcctcgacgccagcagccggggcacg
agtgccggcaccaaggtgatcatctggccctgcaacggccaggccaaccagcagtggacc
gtcaacgccgacgggacggtcaccggcgcgcagtccaggctctgcctggacgtcaccgga
ggctccaccgccaacggcgccctcgtcgaactgtggacctgcaccggccggagcaaccag
caatggacgctcggatag

DBGET integrated database retrieval system