KEGG   Amycolatopsis mediterranei U32: AMED_6561Help
Entry
AMED_6561         CDS       T01269                                 

Definition
(RefSeq) threonine dehydrogenase-like protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00625  Chloroalkane and chloroalkene degradation
amd00680  Methane metabolism
amd01100  Metabolic pathways
amd01120  Microbial metabolism in diverse environments
amd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    AMED_6561
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMED_6561
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AMED_6561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like FAD_binding_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 9440713
NCBI-ProteinID: YP_003768691
UniProt: A0A0H3DF82
Position
complement(7242185..7243321)
Genome map
AA seq 378 aa AA seqDB search
MKAVVYQGPRSVEVREVPEPKIEQPADAIVKITTTNICGSDLHMYEGRTNVEEGKILGHE
NMGFVAEIGSGVTRIKVGDRVSVPFNIACGTCRNCLEGWTSFCLRANPTEGVDGAAYGYA
NMGPYDGGQAEYLRVPWADFNLLELPGGTEHENDFTMLSDIFPTGWHGTELAGMRPGDRV
VVFGAGPVGLLAAHSAVIRGAAEVYVVDKERDRLAMAEKIGTIPIDLSEADPVEQIMAAT
GGAGADCGVEAVGYQAHDHTGEEHPELVLDNLVKTVRSTGGIGVVGVSLPDDPGAANELA
KHGRIAFDYGSLFMKGQHMGTGQAPVKRYNRQLRDLIITGKANPSFLVSHELPLDQAAEG
YEKFDHRDDGWTKVLLRP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtggtgtaccaaggaccgcgcagcgtcgaggtgcgtgaagtcccggaaccg
aagatcgagcagccggccgacgcgatcgtcaagatcaccacgacgaacatctgcgggtcg
gacctgcacatgtacgaaggccgcacgaacgtcgaagaaggcaagatcctcggccacgaa
aacatgggcttcgtcgccgaaatcgggtccggggtcacccggatcaaggtcggtgaccgg
gtgtcggtgccgttcaacatcgcctgcgggacctgtcgcaactgcctcgagggctggacg
tcgttctgcctgcgcgccaaccccaccgagggagtcgacggtgccgcctacggctacgcg
aacatgggcccatatgacggtggtcaggcggagtacctgcgcgtgccgtgggcggatttc
aacctgctggagctgcccgggggcaccgagcacgagaacgacttcaccatgttgtcggac
atcttcccgaccggctggcacggcaccgagctggccgggatgcgtcccggtgaccgggtc
gtggtgttcggcgccgggccggtcgggctgctggccgcgcacagcgcggtgatccggggt
gcggccgaggtctacgtcgtggacaaggaacgtgaccggctggccatggccgagaagatc
ggcaccatcccgatcgacctgtccgaggccgaccccgtcgagcagatcatggccgcgacc
ggcggcgcgggcgccgactgcggcgtcgaggcggtgggctaccaggcgcacgaccacacc
ggcgaagagcacccggagctggtgctggacaacctggtcaagacggtgcgttcgaccggc
ggcatcggcgtggtcggggtgtccctgccggacgacccgggcgcggcgaacgaactggcc
aagcacggccggatcgccttcgactacggcagcctcttcatgaagggccagcacatgggc
accggccaggccccggtcaagcgctacaaccggcagctgcgcgacctcatcatcaccggg
aaggcgaacccgtcgttcctggtctcgcacgagctgccgctggatcaggccgcggagggc
tacgagaagttcgaccaccgcgacgacggctggaccaaggtcctgttgcgaccgtga

DBGET integrated database retrieval system