KEGG   Amycolatopsis mediterranei U32: AMED_6575Help
Entry
AMED_6575         CDS       T01269                                 

Definition
(RefSeq) phosphoketolase
  KO
K01621  
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMED_6575
Enzymes [BR:amd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     AMED_6575
    4.1.2.22  fructose-6-phosphate phosphoketolase
     AMED_6575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(7259889..7262183)
Genome map
AA seq 764 aa AA seqDB search
MPARAETLRRYRRACDYLAAAMIHLKDNVLLTEPLRPEHLKPRPLGHWGTCPGLTLVYAG
LNRLVAETGQRTLLVTGPGHGAPAIHANLWLEGTHAVHDPRLGLDGHGLAELVRRFSWPG
GFPSHLSPEVPGVIHEGGELGYALATAFGAALDDPGLLVACVVGDGEAETGPTAAAWHSP
KFTGPGDGRVLPILHLNGYKIASPTIYEAMSDDELTAYFTGCGWHPEIVDVRGTDDPDTP
LAEALARAHEQPSGPPPMIVLRSTKGLGLPATSPDGTPLAGTFHAHQVPLPSAAGDPDEL
AALERWLRSYRPEELFGADGVPAPDLLEVPPAPELRLGRVPQANGGQLRRDLPLPDVEKY
AVAVDRPGGVDASAPEVLAGWLAELIGRAPETFRVVCPDELESNKLGGLLEATSRQFDAE
VPGYSEHLATRGRVQEVLSEHLCQGWLQGYLLTGRHGLFPCYEAFVSIVDSMVNQYAKFL
KMSAEVSWRAPVASLNYLLSSDGWRQEHNGYSHQGPGFINQMLTKKATTARVYLPPDANT
LLEVMHRCLASTDLINVVVTGKQSSPQWLSPEEARAHCRAGASVWEWASTADGDADVVLA
CAGTTPTLETIAAAELLRELAPDLRVRVVNVVDLLSLCPPDRHPHGLADEAFTACFGDDL
PVVFAFHGYPSAVHEVLHGRPATARFHVHGYREEGTTTTPFDLLASNRMTRHDLAADAVT
RARGWASAGGDLARELVKRRDALLVQSYRDGQDPEEITGWRWRG
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgcccgggccgaaaccctgcgccgctaccggcgcgcgtgcgactacctcgctgcc
gcgatgatccacctgaaggacaacgtcctgctcacggagccgctgcggcccgaacacctc
aagccgcgcccgctcgggcactggggcacctgccccgggctgacgctggtctacgccggg
ctgaaccggctggtcgcggagaccgggcagcggacgttgctggtcaccggacccggccac
ggcgccccggccatccacgccaacctctggctggagggcacccacgccgtccacgacccc
cggctgggcctggacgggcacgggctggccgagctggtccggcggttctcctggccgggc
gggttccccagccacctctcgccggaggtgcccggtgtcatccacgagggcggcgagctg
ggctacgccctggccacggccttcggcgcggcgctcgacgaccccgggctgctcgtggcg
tgcgtcgtcggcgacggcgaggccgagaccggtccgacggcggccgcgtggcacagcccg
aagttcaccggtccgggtgacgggcgggtgctgccgatcctgcacctcaacggctacaag
atcgcgtcgccgacgatctacgaagcgatgtccgacgacgagctgaccgcctacttcacc
ggctgtggctggcacccggaaatcgtcgatgtccgcggcaccgacgatccggacaccccg
ctcgccgaggcactggcccgggcgcacgagcagccgagcggaccgccgccgatgatcgtc
ctgcgcagcaccaagggcctcggcctgcccgccacctcgcccgacgggactccgctggcc
ggcacgttccacgcccaccaggtcccgctgccgtccgcggccggcgacccggacgagctc
gccgcgctcgagcgctggctgcgctcctaccggccggaagagctgttcggcgccgatggc
gtccccgctcccgacctgctcgaggtgcctcccgcgcccgagctgcggctggggcgggtc
ccgcaggcgaatggcgggcagttgcgccgtgacttgccgctgccggacgtcgaaaagtac
gcggtcgccgtcgaccggcccggtggtgtggacgcgagcgcgcccgaagtcctcgccggc
tggctggccgagctcatcggccgggcgccggagacgttccgggtcgtctgccccgacgaa
ctggagtccaacaagctgggtgggctgctggaggccacgtcgcgccagttcgacgccgag
gtgcccggctactccgaacacctcgcgacgcgcggccgggtgcaggaagtgctctcggag
cacctgtgccaggggtggttgcagggctacctgctcaccggccggcacggcctgttcccg
tgctacgaagccttcgtgtccattgtggacagcatggtgaaccagtacgccaagttcctc
aagatgtcggccgaggtgtcgtggcgcgcaccggtggcgagcctgaactacctgctcagc
agcgacggctggcgccaggagcacaacggctacagccaccagggccccgggttcatcaac
cagatgctgacgaagaaggccaccaccgcgcgcgtctacctgccaccggacgcgaacacg
ctgctggaggtcatgcaccgctgcctcgcctcgaccgacctgatcaacgtggtcgtcacc
ggcaagcagagcagtcctcagtggctctcgcccgaagaagcccgcgcccattgccgggcc
ggggcgtcggtgtgggagtgggcgagcaccgccgacggcgacgccgacgtcgtgctggcc
tgcgcgggcaccaccccgaccctggagaccatcgcggccgccgagctgctgcgcgagctc
gcgccggacctgcgggtgcgggtggtcaacgtcgtggacctgctgtcgctgtgcccgccc
gaccggcacccgcacgggctggcggacgaggcgttcaccgcctgcttcggcgacgacctg
ccggtggtgttcgccttccacggttacccgtcggcggtgcacgaggtcctgcacggcagg
ccggccaccgcccggttccacgtgcacggctaccgcgaggagggcaccacgaccacgccg
ttcgacctgctggcgagcaaccggatgacccgccacgacctcgccgccgatgccgtcacc
cgcgcccgcggctgggcctcggccggcggcgacctcgcccgcgagctggtcaagcgccgg
gacgcgctgctcgtacagtcctaccgggacggtcaggacccggaagagatcaccggctgg
cggtggcgcggatga

DBGET integrated database retrieval system