KEGG   Amycolatopsis mediterranei U32: AMED_6693Help
Entry
AMED_6693         CDS       T01269                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMED_6693 (gpm)
   01230 Biosynthesis of amino acids
    AMED_6693 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_6693 (gpm)
  Energy metabolism
   00680 Methane metabolism
    AMED_6693 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMED_6693 (gpm)
Enzymes [BR:amd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AMED_6693 (gpm)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AMED_6693 (gpm)
  Exosomal proteins of melanoma cells
   AMED_6693 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(7372629..7373243)
Genome map
AA seq 204 aa AA seqDB search
MSPRRLVLWRHGETDYNAAGRMQGHLDSALTPRGWNQARFAVPALARFSPDLVIASDLRR
ATDTATVLTDAIGVPLRIDKRLRETHLGEWQGLTGEQVDQAYPGERDRWRTDATWAPPGG
ESRVDVADRAGEVVTDLQQANSDAGDTVLLAAHGGLIIALTARLLDLPVVAWPSLGGISN
CHWVELGRRDGKWRLHAYNAGMHG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcggcggctggtgctctggcgtcacggcgagacggactacaacgccgccggg
cggatgcagggtcacctcgactcggcgctgaccccgcgcggctggaaccaggcccggttc
gcggtgcccgcactggcccgcttctccccggacctcgtcatcgcctccgacctgcgccgg
gccaccgacaccgccaccgtgctcaccgacgccatcggcgtcccgctgcggatcgacaag
cggctgcgggagacgcaccttggcgaatggcaggggctcaccggcgagcaggtcgaccag
gcctaccccggtgaacgcgaccgctggcgcaccgacgcgacctgggccccgccgggcggc
gagagccgggtcgacgtcgccgaccgcgcgggggaagtcgtcacggacctgcagcaggcc
aactccgacgcgggtgacaccgtgctgctggccgcgcacggcggcctgatcatcgcgctg
accgcgcggctgctggacctgccggtcgtggcctggccgtcgctcggcgggatctcgaac
tgccactgggtcgagctgggccgccgcgacgggaagtggcggctgcacgcctacaacgcg
gggatgcacggctag

DBGET integrated database retrieval system