KEGG   Amycolatopsis mediterranei U32: AMED_6693Help
Entry
AMED_6693         CDS       T01269                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
amd  Amycolatopsis mediterranei U32
Brite
Enzymes [BR:amd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     AMED_6693 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 9440845
NCBI-ProteinID: YP_003768821
UniProt: A0A0H3DFJ5
Position
complement(7372629..7373243)
Genome map
AA seq 204 aa AA seqDB search
MSPRRLVLWRHGETDYNAAGRMQGHLDSALTPRGWNQARFAVPALARFSPDLVIASDLRR
ATDTATVLTDAIGVPLRIDKRLRETHLGEWQGLTGEQVDQAYPGERDRWRTDATWAPPGG
ESRVDVADRAGEVVTDLQQANSDAGDTVLLAAHGGLIIALTARLLDLPVVAWPSLGGISN
CHWVELGRRDGKWRLHAYNAGMHG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcggcggctggtgctctggcgtcacggcgagacggactacaacgccgccggg
cggatgcagggtcacctcgactcggcgctgaccccgcgcggctggaaccaggcccggttc
gcggtgcccgcactggcccgcttctccccggacctcgtcatcgcctccgacctgcgccgg
gccaccgacaccgccaccgtgctcaccgacgccatcggcgtcccgctgcggatcgacaag
cggctgcgggagacgcaccttggcgaatggcaggggctcaccggcgagcaggtcgaccag
gcctaccccggtgaacgcgaccgctggcgcaccgacgcgacctgggccccgccgggcggc
gagagccgggtcgacgtcgccgaccgcgcgggggaagtcgtcacggacctgcagcaggcc
aactccgacgcgggtgacaccgtgctgctggccgcgcacggcggcctgatcatcgcgctg
accgcgcggctgctggacctgccggtcgtggcctggccgtcgctcggcgggatctcgaac
tgccactgggtcgagctgggccgccgcgacgggaagtggcggctgcacgcctacaacgcg
gggatgcacggctag

DBGET integrated database retrieval system