KEGG   Amycolatopsis mediterranei U32: AMED_6776Help
Entry
AMED_6776         CDS       T01269                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:amd00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:amd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7469693..7470841
Genome map
AA seq 382 aa AA seqDB search
MSDFAPQPADKFTFGLWTVGWPANDPFGVATRPPLDPVESVHRLAELGAYGVTFHDDDLL
ATEPDRDKAIERFRKALAETGLKVPMATTNLFTHPVFKDGGLTSNDRDIRRYALRKVRRN
LDLAAELGAQTYVVWGGREGAESDAAKDVRAALDRYKEGLDLLADYVVEKGYSLRFALEP
KPNEPRGDILLPTIGHALGFISQLARPEMFGLNPEVGHEQMAGLNFVHGISQALWQGKLF
HIDLNGQHGPKFDQDLIFGHGDLKSAFFLVDLLENAGYDGPRHFDYKPMRTEDAEDVWVS
AAANMRTYLILKEKSAAFRADPEVVEALAASRVPDLSTPTLAPGETFDDVLNDEFDLEAA
AARGYHFTRLNQLALEHLLGVR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttcgctccccagccggccgacaagttcaccttcggcctctggaccgtgggc
tggcccgcgaacgacccgttcggagtcgcgacgcggccgccgctggacccggtggagagc
gtgcaccggctggcggagctgggcgcctacggcgtgaccttccacgacgacgacctgctg
gccaccgagccggaccgcgacaaggcgatcgagcgcttccgcaaggcgctcgccgaaacc
ggcctcaaggtgccgatggcgacgacgaacctgttcacccacccggtgttcaaggacggc
ggcctgaccagcaacgaccgcgatatccgccggtacgcgctgcggaaggtgcgccgcaac
ctcgacctggcggccgagctgggcgcgcagacgtacgtcgtctggggcggccgcgaaggc
gccgagtccgacgccgcgaaggacgtccgcgcggccctggaccgctacaaggagggcctg
gacctgctcgccgactacgtcgtcgagaagggctactcgctgcggttcgcgctggagccg
aagccgaacgagccgcggggcgacatcctgctgccgacgatcgggcacgcgctgggcttc
atctcgcagctcgcgcggccggagatgttcgggctgaacccggaggtcgggcacgagcag
atggccgggttgaacttcgtgcacggcatctcgcaggcgctgtggcagggcaagctgttc
cacatcgacctcaacggccagcacggcccgaagttcgaccaggacctgatcttcggccac
ggcgacctgaagagcgcgttcttcctggtcgacctgctggagaacgccggctacgacggc
ccgcggcacttcgactacaagccgatgcgcaccgaggacgccgaagacgtctgggtgtcg
gcggcggcgaacatgcggacctacctgatcctcaaggagaagtcggcggcgttccgggcc
gacccggaagtcgtggaggcgctggcggcgtcgcgggtcccggacctttcgacgccgacg
ctggccccgggcgagacgttcgacgacgtcctgaacgacgagttcgacctggaagcggcg
gccgcccgcggctaccacttcacccggctgaaccagctcgccttggagcacctgctcggc
gtgcgctga

DBGET integrated database retrieval system