KEGG   Amycolatopsis mediterranei U32: AMED_6804Help
Entry
AMED_6804         CDS       T01269                                 

Gene name
galA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:amd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7503077..7504645)
Genome map
AA seq 522 aa AA seqDB search
MSSPRRIASAATALAIAASGLVLGAPTAAALENGLLRTPPMGFNNWNSTQCKADFNETMI
KGIADIFVSKGLKDAGYTYVNIDDCWALPSRNSAGNLVPDPARFPDGIKALADYVHGKGL
KFGIYTSAGTKTCNKAGFPGALNHEQQDANLFASWGVDYLKYDNCNNQGVDAQQRYKAMR
DALAKSGRAIAYSICEWGQNQPWTWAAPVGNLWRTTGDISDKWSSMIGKAQTNRGLAQYA
GPGHWNDPDMLEVGNGGMTAAEYRTHFSLWAMMAAPLLIGSDLRKVSDDNFAILKNTDVI
ALDQDPLGKQATVLSANAGLVVYGKVLSNGDRAVALSNETAATATIGTTASATGIGSASS
YTLKDLWSKATRTTTGTISASVPSHSTVLYRVSRAGGSTRYEAESASISAGGTIDANHAG
FSGTGFANGANAVGSYVEWQVTGPASALAFGYANGTTAARPVDVAVDGTVVAAGVPFPAT
GAWTTWSTVVRSLSLPAGSHTVRLTATTADGPANLDYLDVTP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcacctcgtcgaatcgcgagcgcggccaccgcgctcgcgatcgcggccagcggt
ctcgtcctgggtgcgcccacggcggcggccctcgaaaacggcctgctgcgcacaccgccg
atgggcttcaacaactggaactccacgcagtgcaaagccgacttcaacgaaacgatgatc
aaaggcattgcggacatcttcgtcagcaaggggctgaaggacgccggttacacctacgtc
aacatcgacgactgctgggcgctgccgtcccgcaactcggcgggcaacctggtgcccgat
ccggcgcggttccccgacggcatcaaggccctcgccgactacgtgcacggcaagggcctg
aagttcggcatctacaccagtgccggcacgaagacctgcaacaaggcgggcttccccggc
gcgctgaaccacgagcagcaggacgcgaacctgttcgcctcctggggcgtcgactacctg
aagtacgacaactgcaacaaccagggcgtcgacgcgcagcagcggtacaaggcgatgcgg
gacgcgctcgcgaagtccggccgcgcaatcgcgtactccatctgcgagtggggccagaac
cagccgtggacgtgggccgcgccggtcgggaacctgtggcgcaccaccggcgacatctcc
gacaagtggtcgagcatgatcggcaaggcgcagaccaaccgcggcctcgcgcagtacgcc
ggccccggccactggaacgaccccgacatgctggaggtcggcaacggcgggatgaccgcg
gcggagtaccgcacgcacttcagcctgtgggcgatgatggcggcgccgctgctgatcggc
agcgatctgcgcaaggtgtcggacgacaacttcgcgatcctgaagaacaccgacgtcatc
gcgctcgaccaggacccgctgggcaagcaggcgaccgtgctgagcgccaacgccggcctc
gtcgtctacggcaaggtgctgtccaacggcgaccgcgcggtggcgctgtccaacgaaacg
gccgcgacggcgacgatcggcacgacggcgtccgccaccgggatcgggagcgcctcgtcg
tacacgctcaaggacctgtggagcaaggcgacccggacgaccaccggcacgatcagcgca
tcggtgccctcgcactcgacggtgctgtaccgcgtatcccgcgccggcggttcgacgcgc
tacgaagccgagtccgcgtccatttcggcgggcggcacgatcgacgccaaccacgcgggc
ttctccgggaccggcttcgcgaacggagccaacgcggtcggcagctacgtcgagtggcag
gtgacgggaccggcatcggcgctggcgttcggctacgcgaacggcacgacggcggcgcgt
ccggtggacgtcgcggtggacggcacggtggtggccgcgggcgtcccgttcccggcgacc
ggcgcctggacgacgtggagcacggtggtccggtccttgtccttgccggcgggctcgcac
acggtccgcctgaccgcgacgacggccgacggcccggcgaacctcgactacctggacgtc
acgccgtag

DBGET integrated database retrieval system