KEGG   Amycolatopsis mediterranei U32: AMED_7041Help
Entry
AMED_7041         CDS       T01269                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMED_7041 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_7041 (glk)
   00052 Galactose metabolism
    AMED_7041 (glk)
   00500 Starch and sucrose metabolism
    AMED_7041 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_7041 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AMED_7041 (glk)
   00524 Butirosin and neomycin biosynthesis
    AMED_7041 (glk)
Enzymes [BR:amd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AMED_7041 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7782399..7783295)
Genome map
AA seq 298 aa AA seqDB search
MVAALDVGGTTIKAALLDEQLQPKAALRAETARSADGTALAAQTADIVAALAEQAGTGQP
AAVGVVVPGIVDEQTRVCHFSANLDWREVPFGELLEDRIGLPVAFGHDVTAGGIAEFRVG
AGRGATNAAFIPVGTGIAAALLLDGRIHRAHGQAGEVGHIDVGHAGKCGCGATGCLEAIS
SAAAIARRYTERTGRPADGAREVVELARRGDEVAVAVVQDALDGLGHGIRTLLTLLGPEV
IILGGGLFTAADYVLEPVREWLAAHLTFQTMPELRIAELGDEAGRLGAGLLAFDQLDA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgccctcgatgtgggcggaacgacgatcaaggccgcgttgctcgacgagcag
ctgcagcccaaggcggcattgcgcgcggagacggcccgcagcgcggacgggacggcgctg
gccgcgcagaccgcggacatcgtggccgcgctggccgagcaggcgggcaccgggcaaccc
gcggcggtgggggtggtggtgccggggatcgtcgacgagcagacccgcgtctgccacttc
tcggccaacctcgactggcgtgaagtccccttcggcgagctcctggaagaccggatcggg
ctgccggtcgccttcgggcacgacgtcaccgcgggcggcatcgccgagttccgggtgggc
gccgggcgcggcgcgacgaacgcggcgttcatcccggtcggcaccgggatcgccgccgcg
ctgctgctcgacggccggatccaccgcgcgcacgggcaggccggcgaggtcgggcacatc
gacgtcggccacgccggcaagtgcggctgcggcgcgaccggctgcctggaggcgatctcg
tcggcggccgcgatcgcccgccgctacaccgagcgcaccggccgcccggccgacggcgcc
cgcgaggtcgtggagctggctcgccgcggggacgaggtcgcggtcgccgtggtccaggac
gcgctcgacgggctcggccacgggatccggacgctgctgacgctgctcggcccggaggtg
atcatcctgggcggcggcctgttcaccgcggccgactacgtgctggagccggtgcgcgaa
tggctggccgcgcacctgacgttccagacgatgccggagctgcggatcgccgagctgggc
gacgaagccgggcggctcggcgccgggctgctggcgttcgaccagctcgacgcctga

DBGET integrated database retrieval system