KEGG   Amycolatopsis mediterranei U32: AMED_7054Help
Entry
AMED_7054         CDS       T01269                                 

Gene name
chlD
Definition
magnesium chelatase subunit ChlD
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMED_7054 (chlD)
Enzymes [BR:amd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AMED_7054 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7794118..7796058)
Genome map
AA seq 646 aa AA seqDB search
MKPYPFTAVVGLPDLRLALVLSSISPAVGGVLVRGEKGTAKSTMVRALAGLLPGVDVVDG
CRFSCDPAAPDPLCPDGPHDGANSHRRPAKLVELPVGAAEDRVIGSLHLERALAEGVTDF
QPGLLAAAHRGLLYVDEVNLLHDHLVDTLLDAAAMGRATVEREGVSVSHAARFVLIGTMN
PEEGELRPQLLDRFGLTVEVASSRDPEQRVEVVRRRLAYEADPDAFAAQYAGEDARLAAD
IEAAQRLLPAVKLPDEALRRIAEVCASFEVDGMRADIVTARAAVAHAAWAGRDEVTTEDV
RVAARLALPHRRRRNPFDAPGISEEQLEQALQDAEPDPGPEDDGPGSGSAPSQDEAPQGK
APQGEPKQQNGGQQKTVGAGDTFKARVFRVKGMGEGERGRRSRAITDSGRTIGVQPASVR
EGRPHLVATVKAAAPHQKARGRTGAGLELRPEDLRFALREGREGNLVLFCVDASGSMGAK
ARMREVKSAVLSLLLDAYQRRDKVGLVTFRGDAAELALPPTISVDAAASRLEGLPTGGRT
PLAEGLLEAARVLRVEEIRDPRRRPLLVVVTDGRATSGPDAVARAKAAAGLLAGVTTILM
DCESGKMRLGLAADLAAHLGAEHVPLADVAAESLADAVRARTGRAA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaagccgtacccgttcaccgccgtagtcgggctgccggacctgcgcctggcgctggtc
ctgtcctcgatctcgcccgccgtcggcggggtgctggtgcgcggcgaaaagggcacggcg
aagtcgaccatggtccgcgcgctcgccggcctgctgccgggtgtcgacgtcgtcgacggc
tgccggttctcctgcgatcccgcggctcccgacccgctctgcccggacggcccgcacgac
ggcgcgaacagccaccggcggcccgcgaagctggtcgaactcccggtcggcgccgccgaa
gaccgcgtcatcggctcgctgcacctcgaacgcgcgctcgccgaaggcgtcacggacttc
cagcccggcttgctggccgccgcgcaccgcgggctgctctacgtcgacgaggtcaacctg
ctgcacgaccacctcgtcgacacgctcctggacgccgcggcgatgggccgcgcgaccgtg
gaacgcgaaggcgtttcggtctcgcacgccgcgcggttcgtgctgatcggcaccatgaac
cccgaagagggcgagctccggccgcagctgctggaccggttcgggctgaccgtcgaggtc
gcctccagccgcgatccggagcagcgcgtcgaggtcgtccgccgtcgcctggcctacgaa
gccgatcccgacgccttcgccgcgcagtacgccggcgaagacgcccggctcgccgcggac
atcgaagcggcacaacggcttctgcccgcggtcaagctccccgacgaggccctgcgccgg
atcgccgaggtctgcgcgtccttcgaggtcgacggcatgcgcgcggacatcgtcacggca
cgggcggcggtcgcgcacgcggcctgggccggccgcgacgaggtgaccaccgaggacgtc
cgcgtcgccgcgcggctcgcgctgccgcaccggcgccgccggaacccgttcgacgcaccg
gggatctcggaagagcagctggagcaggcgttgcaggacgccgaaccggacccggggccc
gaggacgacggccccggctcgggctcggcgccgtctcaagacgaagccccgcagggcaag
gcacctcaaggcgaaccgaagcagcagaatggcggtcagcagaagaccgtcggcgccggc
gacacgttcaaggcacgcgtcttccgcgtcaaaggaatgggcgagggtgaacgcggacgc
cgttcgcgcgcgatcaccgacagcggccggacgatcggcgtccagcccgcgagcgtccgc
gaaggccggccgcacctggtcgcgaccgtgaaagccgcggcaccgcaccagaaagcccgc
ggccgcaccggcgccgggctcgaactgcgtccggaagacctgcggttcgcgctgcgcgaa
ggccgcgaaggcaacctcgtgctgttctgcgtggacgcgtccggttcgatgggcgcgaag
gcgcggatgcgcgaggtcaagtccgcggtcctgtcgctgctgctcgacgcctaccagcgc
cgcgacaaggtcgggctcgtcacgttccgcggcgacgcggccgaactcgcgctgccgccg
acgatcagcgtcgacgcggccgcgtcccgcctcgaaggcctcccgaccggcggccggacg
cccctggccgaagggctcctggaggcggcgcgcgtgctgcgtgtcgaggagatccgcgac
ccccggcgccgtccgctgctggtcgtcgtcaccgacggccgcgccaccagcggtcccgac
gccgtcgcccgcgccaaggccgcggccgggctcctggccggcgtcacgacgatcctcatg
gactgcgagagcggcaagatgcgcctcggcctggccgccgacctcgccgcccacctcggc
gcggaacacgtccccctcgccgacgtcgccgccgaatcgctggcggacgccgtccgcgcc
cggaccggaagggccgcctga

DBGET integrated database retrieval system