KEGG   Amycolatopsis mediterranei U32: AMED_7123Help
Entry
AMED_7123         CDS       T01269                                 

Definition
fatty-acyl-CoA synthase
Organism
amd  Amycolatopsis mediterranei U32
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7865478..7866983
Genome map
AA seq 501 aa AA seqDB search
MYNFAGVVEHNAAHHPDQVVLSQGERRLTGHELDERVNALAAGLRDLGVGPGDIVALLLY
NHLEFLEAVFALNRLGAAFLPLNYRLSPVEWEFILGHASVVAILTEPEFADALPTQGLKH
RILLGERKPGWQSYDDLVTAHHGDRVPLADVGAHDLQRLMYTSGTTSRPKGVPITHHNLL
FKNLAHIVEFGLGRDDRTLVCGPLYHVGGLDLPGLGTLHAGGSLHLVRKFDAAEVVDLIE
RERPTNIWLAPSMMNAILQLPGLRERDTSSLRFIIGGGEKMPVPLVQRIQEAFPTAWFAD
AYGLTETVAGDTFNDADHVLRKVGSVGRPVQHLRVRIVDEHDAEVPTGQLGEITLAGPKV
FSGYWRDEEATTKAIRDGWFHTGDVGRLDEDGYLYVEDRKKDMIVSGGENIATPEVERVL
YEHPDVVEAAVVGLPHERWGEVPQAFVVARPGSGLDAVTLVAHCRERLAKFKVPAEIRFV
DELPRTPSGKVLKRDLRTANA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacttcgccggcgtcgtcgagcacaacgcggcccaccaccccgaccaggtcgtg
ctctcccagggagagcgaaggctcaccggccacgagctcgacgagcgcgtcaacgcgctg
gcggccggtctgcgcgacctcggcgtcggcccgggcgacatcgtcgcactgctgctctac
aaccacctcgaattcctcgaggcggtcttcgcgctcaaccggctcggcgcggcgttcctg
cccctgaactaccgcctctccccagtcgagtgggagttcatcctcggccacgcgtcggtg
gtcgcgatcctcaccgagcccgaattcgccgacgcgctgcccactcaaggcctgaagcac
cgcatcctgctcggcgagcgcaaacccggctggcagtcctacgacgacctcgtcaccgcc
caccacggtgatcgggtcccgctcgccgacgtcggcgcccacgatctgcagcggctcatg
tacacctccggcacgacgtcgcggccgaagggtgtgccgatcacgcaccacaacctgctg
ttcaagaacctcgcgcacatcgtcgagttcggcctcggccgggacgaccgcacgctcgtc
tgcggtccgctctaccacgtcggcggcctcgacctgcccggcctcggaaccctgcacgcg
ggcggcagcctccacctggtgcgcaagttcgacgcggccgaggtcgtggatctgatcgag
cgcgaacggccgaccaacatctggctcgcgccgtcgatgatgaacgccatcctgcagctg
cccggcctgcgcgaacgggacacctcctcgctgcggttcatcatcggcggcggcgagaag
atgccggtgcccctggtccagcggatccaggaggcgttcccgaccgcgtggttcgccgat
gcgtacgggctcacggagaccgtcgcgggcgacacgttcaacgacgccgaccacgtgctg
cgcaaggtgggctcggtcgggcggccggtgcagcacctgcgggtccgcatcgtcgacgag
cacgacgccgaggtcccgaccggacagctcggcgagatcaccctcgccggcccgaaggtc
ttctccggctattggcgcgacgaagaagccaccaccaaggccatccgggacgggtggttc
cacaccggagacgtcggccggctcgatgaggacggctacctctacgtcgaggaccgcaag
aaggacatgatcgtctcgggcggcgagaacatcgccactcccgaggtcgagcgcgtgctg
tacgagcacccggacgtcgtcgaggccgcagtggtcgggctgccgcacgagcgctggggt
gaggtgccgcaagcgttcgtcgtggctcggcccggctccggcctggacgccgtgacgctg
gtcgcgcactgccgtgagcggctggcgaaattcaaggtgccggccgagatccgcttcgtc
gacgagctgccgcggacgccgtcgggcaaggtgctgaagcgggacctgcggacggcgaac
gcatga

DBGET integrated database retrieval system