KEGG   Amycolatopsis mediterranei U32: AMED_7375Help
Entry
AMED_7375         CDS       T01269                                 

Gene name
adh
Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00071  Fatty acid degradation
amd00350  Tyrosine metabolism
amd00625  Chloroalkane and chloroalkene degradation
amd00626  Naphthalene degradation
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_7375 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    AMED_7375 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AMED_7375 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMED_7375 (adh)
   00626 Naphthalene degradation
    AMED_7375 (adh)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AMED_7375 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Sacchrp_dh_NADP KR ADH_N_2 NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 9441523
NCBI-ProteinID: YP_003769491
UniProt: A0A0H3DHG1
Position
complement(8143914..8144984)
Genome map
AA seq 356 aa AA seqDB search
MTAFGSPLEVHDVPDPEAGTGEVLVEVLATCVPPYAAEVFSGQRRYPLEPPVVPGVGGIG
RLVHVGPDATKLAVGDLVWCDSTVRARDDALTPDITLQGWSSRGDGGARLARYLHDGPFA
ELMRVPTENVHPLPAGAAADPARWSALGVHTIPYGGLLAGRLAAGETVLISGATGNLGSS
AVAVALAMGAGHVVAPGRNRAALDLLAGRFGARVSPVGLSGDEDRDRAAMAAAAVGPIDL
VLDLLPPRAPSSVARAAAMTVREYGRVVLMGGVGMLGGADFALPYPWIMRNSVTVRGQWM
YPRTANAGMIRLVATGALDLTPEDVTRFGLDRVNDAVAHAAAHGGPFDRTVLTPRA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcgttcggctccccgctcgaggtgcacgacgtccccgacccggaagccggcacc
ggtgaggtgctggtcgaggtgctggccacctgcgtgcccccgtacgcggccgaagtgttc
agcggccagcggcgctatccgctggaaccaccggtcgtgccgggggtcggcgggatcggc
cggctggtccacgtgggaccggacgcgaccaagctcgcggtgggcgacctggtgtggtgc
gactcgacggtgcgcgcccgcgacgacgccctgaccccggacatcacgctgcagggctgg
agctcccgcggtgatggtggcgcccggctggcccggtacctgcacgacgggccgttcgcc
gaactgatgcgggtacccaccgagaacgtccaccccctgcccgccggcgccgcggccgat
cccgcgcgctggtccgcgctgggggtgcacaccattccctacggcgggctgctggccggc
cggctcgcggccggggagacggtgctgatcagcggggcgaccggcaacctcggcagcagc
gcggtggccgtcgcgctcgccatgggggccgggcacgtggtggccccgggccgcaaccgg
gccgccctcgacctgctcgccggccggttcggcgcccgggtgagcccggtcgggctcagc
ggggacgaggaccgcgaccgcgcggccatggccgcggccgccgtcggcccgatcgacctc
gtgctcgacctcctcccgccccgggcacccagctcggtggcccgtgccgccgccatgacc
gtgcgcgagtacgggcgggtcgtgctgatgggcggcgtcggcatgctcggcggcgcggac
ttcgccctgccctacccctggatcatgcgcaactcggtgaccgtacgcggccagtggatg
tacccgcgcacggcgaacgccgggatgatccggctcgtcgcgacgggcgcactggacctc
acgcccgaagacgtcacccgcttcggcctcgaccgggtcaacgacgcggtggcccacgcg
gccgcccacggcggacccttcgaccggacggtcttgactccgagggcttga

DBGET integrated database retrieval system