KEGG   Amycolatopsis mediterranei U32: AMED_7505Help
Entry
AMED_7505         CDS       T01269                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:amd00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8292257..8293828)
Genome map
AA seq 523 aa AA seqDB search
MASAALAGRATAASSQPAVAGSAAAISDGARVTALVIGTGYGGSVAALRLAQAGVDVQMV
EMGMAWDTPGADGKIFCTTPNPDQRSFWLRTRTKQPLSNFLGFPIDKDIPRYTGILDAEE
FSGITVYQGRGVGGGSLVNGGMAVTPKRENFGAILPTVDANEMYDVYYPRANAGLGVASV
RPAWFETTDWYQFARVGRKQAQRSGFPFVFVPDVYDWDYMEREAAGTATKSALAGEILFG
NNYGKKSLQKTYLPKIAATGRVTISPLHRVTQVVPASGGGYTVTIEQLTTDGAVSAIKTV
TAAKVFFAAGSVGTSKLLVKLKATGALPNLNGEVGKGWGDNGNVMVGRANQIWDPTGASQ
STIPCGGIDNWAAGGAFAEVAPLPTGIETWASFYLSITKNPNRAQFTWNPTTRAVDLNWQ
TAWKQPGIDMAKTIFDKINATEGTIYRTDLFGTYKTWGDHLTYHPLGGAVLGKATDNYGR
LAGHPGLYAIDGSLIPGNTSVNPFVTITALAERNIEKIIAQDF
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
ttggcgagcgccgcgctggccggtcgggccacggcagcgtcgtcgcagccggctgtggcg
ggctcggcggccgcgatttccgacggcgcccgggtgaccgcgctggtgatcggcaccggg
tacggcggctcggtcgccgcgctgcggctggcccaggccggcgtcgacgtgcagatggtc
gaaatgggcatggcctgggacaccccgggcgccgacggcaagatcttctgcaccacgccc
aatccggaccagcggtcgttctggttgcgcaccaggacgaagcagccgttgtcgaacttc
ctcgggttcccgatcgacaaggacatcccgcgctacacgggcatcctcgacgccgaggag
ttcagcgggatcaccgtgtaccagggccgcggcgtcggcggtggctcgctcgtcaacggc
ggcatggccgtcacgccgaagcgggagaacttcggcgcgatcctgccgacggtcgacgcg
aacgagatgtacgacgtctactacccgcgggcgaacgccgggctcggggtcgccagtgtc
cgcccggcctggttcgagaccaccgactggtaccagttcgcccgtgtcggccggaaacag
gcccagcggtccggtttcccgttcgtgttcgtgccggacgtgtacgactgggactacatg
gaacgggaggcggcgggcaccgccacgaagtcggcgctggccggggaaatcctgttcggc
aacaactacggcaagaaatcgctgcagaagacctacctgccgaagatcgccgcgaccggc
cgggtcaccatctcgccgctgcaccgcgtgacgcaggtggtgccggcctccggcggcggc
tacaccgtgaccatcgagcagctcaccaccgacggcgcggtgtccgcgatcaaaaccgtc
acggcggccaaggtgttcttcgccgcgggcagcgtcggcacgagcaagctgctggtgaag
ctgaaggcgaccggcgcgctgccgaacctcaacggcgaagtcgggaagggctggggcgac
aacgggaacgtgatggtcgggcgcgccaaccagatctgggacccgaccggggcctcccaa
tcgaccatcccgtgcggcggtatcgacaactgggccgcgggcggcgcgttcgccgaggtc
gcgccgctgccgaccgggatcgagacgtgggcgtcgttctacctctcgatcacgaagaac
cccaaccgcgcgcagttcacctggaaccccacgacgcgcgcggtggacctgaactggcag
acggcgtggaagcagccgggcatcgacatggcgaagaccatcttcgacaagatcaacgcg
accgagggcacgatctaccggaccgacctcttcggcacgtacaagacctggggcgaccac
ctcacctaccacccgctcggaggcgcggtgctcggcaaggcgaccgacaactacggcagg
ctcgccggccacccgggcctgtacgcgatcgacggctcgctgatcccgggcaacaccagc
gtcaacccgttcgtcaccatcaccgcactggcggaacgcaacatcgagaagatcatcgcg
caggacttctga

DBGET integrated database retrieval system