KEGG   Amycolatopsis mediterranei U32: AMED_7719Help
Entry
AMED_7719         CDS       T01269                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AMED_7719
Enzymes [BR:amd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AMED_7719
    3.5.1.-  
     AMED_7719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8504546..8505124
Genome map
AA seq 192 aa AA seqDB search
MGTALIVVDVQNDFCEGGSLGLPGGAAAAAGISKQAAEGGYSHVVATRDNHIDPGDHFSE
TPDFKDSWPVHCVAGTPGASFHPALDVVPIGEVFSKGEYSAAYSGFEGSARDGKSLEAWL
REHDVTDVDVVGIATDFCVRATALDAAKAGFGVRVLLDLTVGGSQPTVDATLEDFDKAGV
AYTGTAVVGPAA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgcgctgatcgtggtggacgtgcagaacgacttctgcgaagggggctcgctc
ggtctgccgggcggggccgccgcggccgccggcatctcgaagcaggccgcggaaggcggg
tacagccacgtcgtggccacccgggacaaccacatcgaccccggagaccacttcagcgag
acgccggacttcaaggacagctggccggtgcactgcgtcgccggcacgccgggcgcgtcg
ttccaccccgcgctcgacgtcgtcccgatcggcgaggtgttctccaagggcgagtacagc
gccgcgtactccggcttcgagggctcggcccgcgacgggaagtccctggaggcgtggctg
cgcgagcacgacgtgaccgacgtcgacgtcgtcggcatcgcgacggacttctgcgtccgc
gcgacggcactcgacgcggcgaaggcgggcttcggcgtgcgggtgctgctggacctgacc
gtcggcggctcgcagccgacggtcgacgcgacgctcgaagacttcgacaaggcgggcgtc
gcgtacaccggcaccgccgtcgtcggcccggccgcgtga

DBGET integrated database retrieval system