KEGG   Amycolatopsis mediterranei U32: AMED_7893Help
Entry
AMED_7893         CDS       T01269                                 

Gene name
fadB
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00071  Fatty acid degradation
amd00280  Valine, leucine and isoleucine degradation
amd00281  Geraniol degradation
amd00310  Lysine degradation
amd00362  Benzoate degradation
amd00380  Tryptophan metabolism
amd00410  beta-Alanine metabolism
amd00640  Propanoate metabolism
amd00650  Butanoate metabolism
amd00903  Limonene and pinene degradation
amd00930  Caprolactam degradation
amd01040  Biosynthesis of unsaturated fatty acids
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
amd01212  Fatty acid metabolism
Module
amd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMED_7893 (fadB)
   00650 Butanoate metabolism
    AMED_7893 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    AMED_7893 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    AMED_7893 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMED_7893 (fadB)
   00310 Lysine degradation
    AMED_7893 (fadB)
   00380 Tryptophan metabolism
    AMED_7893 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMED_7893 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMED_7893 (fadB)
   00281 Geraniol degradation
    AMED_7893 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMED_7893 (fadB)
   00930 Caprolactam degradation
    AMED_7893 (fadB)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AMED_7893 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMED_7893 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AMED_7893 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 2-Hacid_dh_C F420_oxidored AlaDh_PNT_C NAD_binding_8 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 9442035
NCBI-ProteinID: YP_003770001
UniProt: A0A0H3DIU1
Position
complement(8683908..8686079)
Genome map
AA seq 723 aa AA seqDB search
MAESKTIRWDQDSDGIVTLTLDDPNQSANTMNAAFRESLGVTVDRLEAEKDSITGVVITS
AKKTFFAGGDLNDLIQAKPEHAAELTEGSSLMKGQMRRIEQLGKPVVAAINGAALGGGLE
IALATHHRIAADVKGSQIGLPEVTLGLLPGGGGVVRTVRLLGIQSALLNVLLQGQRHRPA
KALELGLVHELVGSVEELVPAAKAWIKANPEGGVQPWDVKGYKIPGGTPSNPSFAANLPA
FPANLRKQIKGANMPAPRAILAAAIEGAQVDVDTALQIETRYFIHLATGQVSKNMTKAFF
FDLQTINSGGSRPDGFEKYTAKKVGVLGAGMMGAAIAYVSAKAGIDVVLKDVSLEAAEKG
KSYAVKLEEKALSRGKTTQEKSDALLAKIKPTGDPADFAGVDFVIEAVFESVELKHKVFG
EIESVVNADAVLGSNTSTLPITTLAEGVQRTEDFIGIHFFSPVDKMPLVEIICGEKTSPA
TLAKVFDYTLQIKKTPIVVNDSRGFFTSRVIGTFINEAVAALGEGVEPASIEQAGAQAGY
PAPPLQLMDELTLTLPRKIRKETREAVEAAGGTWKAHASESVIDRMVEEFDRKGRSTGAG
FYEYDENGKRTGLWPGLRDAFKSGSAEVPFEDLKERMLFAEALETVKCFDEGVLTSVADA
NIGSIFGIGFPAWTGGVIQYINQYEGGLQGFVDRSRELAARYGDHFEPPASLVEKAAKGE
IYE
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagcaagaccatccgctgggaccaggactccgacggcatcgtcaccctgacc
ctggacgacccgaaccagtcggcgaacacgatgaacgccgccttccgcgagtcgctgggc
gtcaccgtcgaccgcctggaggccgagaaggactccatcaccggcgtcgtcatcacgtcc
gccaagaagacgttcttcgccggcggcgacctgaacgacctgatccaggcgaagcccgag
cacgcggccgagctgaccgagggcagctccctgatgaaggggcagatgcgccggatcgag
cagctcggcaagccggtcgtcgcggcgatcaacggcgccgcgctcggcggtggcctggag
atcgcgctggcgacgcaccaccgcatcgccgccgacgtcaagggcagccagatcggcttg
cccgaggtgacgctgggcctgctgcccggcggcggtggcgtggtccgcaccgtgcggctg
ctcggcatccagagcgcgctgctgaacgtcctgctgcagggccagcggcaccgcccggcc
aaggcgctcgagctcggcctggtgcacgaactcgtcggttcggttgaagagctcgttccc
gccgcgaaggcgtggatcaaggcgaaccccgagggcggcgtgcagccgtgggacgtcaag
ggctacaagatccccggcggcaccccgtcgaacccgagcttcgcggccaacctgccggcg
ttcccggcgaacctgcgcaagcagatcaagggcgcgaacatgccggcgccgcgggcgatc
ctggccgccgcgatcgagggcgcgcaggtcgacgtcgacaccgcgctccagatcgagacg
cgctacttcatccacctcgccaccggccaggtctcgaagaacatgacgaaggcgttcttc
ttcgacctgcagaccatcaactccggcggctcgcggcccgacggcttcgagaagtacacc
gcgaagaaggtgggtgtgctcggcgccgggatgatgggtgccgcgatcgcgtacgtgtcg
gcgaaggccggtatcgacgtcgtcctcaaggacgtctcgctcgaggcggccgaaaagggc
aagagctacgcggtcaagctcgaggagaaggccctctcgcgcggcaagaccacgcaggag
aagtcggacgcactgctggcgaagatcaagccgaccggtgacccggccgacttcgcgggc
gtcgacttcgtcatcgaggccgtcttcgagagcgtcgagctgaagcacaaggtgttcggc
gagatcgaaagcgtcgtcaacgccgacgcggtgctgggttccaacacctcgaccctgccg
atcaccacgctcgccgagggcgtgcagcggaccgaggacttcatcgggatccacttcttc
tcgccggtggacaagatgccgctggtcgagatcatctgcggtgagaagacgtcgccggcc
acgctggccaaggtcttcgactacacgctgcagatcaagaagaccccgatcgtcgtcaac
gacagccgcggcttcttcacctcgcgggtgatcggcacgttcatcaacgaggccgtcgcc
gcgctgggcgagggtgtcgagccggcgtcgatcgagcaggcgggtgcgcaggcgggctac
ccggcgccgccgctgcagctgatggacgagctgacgctgaccctgccgcgcaagatccgc
aaggagacccgcgaggcggtcgaggccgcgggcggcacgtggaaggcgcacgcgtcggag
tccgtgatcgaccggatggtcgaggagttcgaccgcaagggccggtcgacgggcgcgggc
ttctacgagtacgacgaaaacggcaagcgcaccgggctgtggccggggctgcgtgacgcg
ttcaagtcgggctcggccgaggtgccgttcgaggacctcaaggagcggatgctcttcgcc
gaggcgctcgagacggtcaagtgcttcgacgagggtgtgctgacgtcggtggccgacgcc
aacatcggctcgatcttcggcatcggcttcccggcctggacgggcggcgtcatccagtac
atcaaccagtacgagggtggcctgcagggcttcgtcgaccggtcccgcgagctggccgcc
cggtacggcgaccacttcgagccgccggcttcgctggtggagaaggccgccaagggcgag
atctacgaataa

DBGET integrated database retrieval system