KEGG   Amycolatopsis mediterranei U32: AMED_8125Help
Entry
AMED_8125         CDS       T01269                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_8125
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AMED_8125
Enzymes [BR:amd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMED_8125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8941581..8942729
Genome map
AA seq 382 aa AA seqDB search
MAFSIVAGCLLVSGLQPRIVAGLAVPLTSDRPVPPPAAPRPAPAGPTSRLERPDDCAPLV
GGLDLRAQVAQLVVVGVSGDNPADTVALVRDHQVGGIFVGGNATALLKDRSLAAVQAVAR
VPVAVSVDEEGGRVQRIDDLDGDLPSARTMAATKSPDEVHALAAERGRRLRARGVTVDFA
PDTDVTGAPDDDVIGDRSFSPDPARVKTYAKAFAEGLRDAGVQPVLKHFPGHGHGSGDSH
EGTVVTPPLDRLRAVDLVPYRGLADYGPVAVMVGHLDVPDLTGGVPASLSPAAYRLLRGE
FAFAGPVVTDDLGAMKAVTAQYPLPEAVLKALQAGADEALWSSGGRVDEVLDRLVKAVQA
GELPKARVQESVTRVLRGKGLC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttctccatcgtggccgggtgtctgctggtctcgggcctgcaaccgcggatcgtg
gccggactggcggtgccgctgacctccgatcggccggttcctccgccggcggctcctcgc
cctgctccggccgggcccacctcgcgtctcgagcggccggacgactgcgccccgctggtc
ggcggcctcgacctccgtgcccaggtcgcgcagctggtcgtcgtgggtgtctccggcgac
aacccggcggacacggtggccctggtgcgcgaccaccaggtcggcgggatcttcgtcggg
ggtaacgcaacagcgttgttgaaagaccgctcgctggccgcggtccaggccgtggcccgg
gtgccggtggcggtgtcggtcgacgaggaaggcggccgcgtccagcgcatcgacgacctc
gacggcgacctgccttcggcccggacgatggccgcgaccaagtcgcccgacgaggtccac
gcgctggccgccgagcggggccgccggctgcgcgcccgcggggtgacggtggatttcgcc
ccggacaccgacgtcacgggcgccccggacgacgacgtgatcggcgaccggtcgttcagc
ccggacccggctcgggtgaagacgtacgcgaaagcgtttgcggagggccttcgcgatgcg
ggtgtgcagccggtgctgaagcacttccccggccacggccacggctcgggcgactcccac
gagggcacggtggtcacgccgccgctcgaccggctgcgcgcggtcgacctggtgccctac
cgcggcctggccgactacggcccggtcgcggtgatggtcggccacctcgacgtgccggac
ctgaccggcggcgtcccggcctccctctcgccagcggcgtaccggttgctgcgcggcgag
ttcgcgttcgccgggccggtggtgaccgacgacctcggggcgatgaaggcggtcacggcg
cagtacccactgccggaggcggtgctgaaggccttgcaggccggcgcggacgaggcgttg
tggtcttccgggggccgggtggacgaggtgctggaccggctggtgaaggccgtgcaggcc
ggcgagctgccgaaggcgcgggtgcaggagtcggtcacccgggtgttgcggggcaagggg
ctctgctga

DBGET integrated database retrieval system