KEGG   Amycolatopsis mediterranei U32: AMED_8246Help
Entry
AMED_8246         CDS       T01269                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMED_8246 (ispE)
Enzymes [BR:amd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AMED_8246 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9070267..9071229)
Genome map
AA seq 320 aa AA seqDB search
MLAVVPPPVTVRVPAKVNLHLAVDDLREDGYHELVTVFQALSLTDEVTVAVTEEPGIEVY
GEGEGSVPTGPKNLAWRAVEALAGHVGRAGEPKVRVVLRKGIPVAGGMAGGSADAAATLV
GLASLWNLDVTRDELAEIAAGLGSDVPFALYGGTALGTGRGEQLVPVLSRHTFHWVLAFA
AEGLSTPKVFGELDRLRAAGNPPRIGSHTPVVEALASGDPRQLALLLGNDLQAAAVSLRP
DLRRTLRAGVNAGALAGTVSGSGPTCAFLCEDAQSAVEVAAELSGAGVCRTVRVAHGPVP
GARVVGGDDANRPTPPRVHA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccgtagttccgcccccagtcaccgtccgggtcccggccaaggtgaacctgcac
cttgcggtcgacgacctgcgcgaagacggttaccacgagctggtgaccgtcttccaggcg
ctgtcgctgaccgacgaagtgaccgtcgcggtcaccgaagagcccggcatcgaggtctac
ggcgagggggagggctcggtcccgaccggcccgaagaacctggcctggcgggcggtcgaa
gcgctggccgggcacgtcggccgcgccggggagccgaaggtccgggtggtgctgcgcaag
ggcatcccggtggccggcggcatggcgggcggcagtgccgacgccgcggcgacgctcgtc
gggctggcgagcctgtggaacctcgacgtcacccgggacgagctggccgaaatcgccgcc
ggcctgggcagcgacgtcccgttcgcgctctacggcggcaccgcgctgggtaccggccgc
ggtgagcagctggtcccggtgctgtcgcggcacacgttccactgggtgctggccttcgcc
gccgaagggctgtccacgccgaaggtgttcggcgaactggaccgcctgcgcgcggcgggc
aacccgccccggatcggctcgcacacgccggtcgtcgaggcgctggcctccggcgacccg
cgccagctggccctgctgctgggcaacgacctgcaggcggcggcggtctcgctgcggccc
gacctgcgccgcacgctccgggcgggggtcaacgcgggcgcgctcgcgggcacggtgtcc
ggctccggcccgacgtgcgcgttcctctgcgaagacgcgcagtcggcggtggaggtcgcg
gccgagctgtcgggtgccggcgtgtgccggacggtccgcgtggcccacggcccggtcccc
ggcgcccgcgtggtcggcggcgacgacgcgaaccggccgacgccgccgcgggtgcacgcg
tga

DBGET integrated database retrieval system