KEGG   Amycolatopsis mediterranei U32: AMED_8311Help
Entry
AMED_8311         CDS       T01269                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMED_8311 (galU)
   00052 Galactose metabolism
    AMED_8311 (galU)
   00500 Starch and sucrose metabolism
    AMED_8311 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_8311 (galU)
Enzymes [BR:amd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AMED_8311 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9151586..9152491)
Genome map
AA seq 301 aa AA seqDB search
MTGAATTQTFRTAIVPAAGLGTRFLPATKAVPKELLPVVDTPGIELVAAEAAAAGAERLV
IVTSPGKDAVVRYFEKQPELERNLEAKGKTELLAKVRRGTDLLAVETAIQEQALGLGHAV
AQAEPNLRPDDEAVAVLLPDDLVLPTGVLERMGAVRAQYGGSVLCAFDIPKAEISPYGVF
DVTDTDDEDVKQVHGMVEKPKPEDAPSTYAAAGRYLLDRAIFDALKRITPGSGGELQLTD
AVALLISEGHPVHVVVHRGGRHDLGNPGGFLRAAVDFALETPEYGPSLRAWLTERIGTER
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgccgcaaccacccagacgttcagaaccgccatcgtgcctgccgccggcctg
gggacacggttcctcccggcgacgaaggccgtgcccaaggagctcctgccggtggtggac
accccgggcatcgagctggtcgcggccgaggccgccgccgccggcgcggaacgcctggtc
atcgtgacctcgccgggcaaggacgccgttgtccggtacttcgaaaagcagcccgagctc
gagcggaacctcgaggccaagggcaagaccgaactgctcgccaaggtgcgccggggcacc
gatctcctcgccgtcgaaaccgccatccaggaacaggccctcggcctgggccacgccgtc
gcgcaggccgagccgaacctgcgcccggacgacgaggccgtcgccgtgctgctcccggac
gacctcgtgctgcccaccggcgtgctcgagcggatgggcgcggtccgcgcccagtacggc
ggcagcgtgctctgcgcgttcgacatcccgaaggccgagatctcgccgtacggcgtcttc
gacgtcaccgacaccgacgacgaagacgtcaagcaggtgcacgggatggtcgagaagccg
aagccggaggacgcgccgtcgacctacgccgcggccgggcggtacctgctcgaccgggcg
atcttcgacgcgctcaagcggatcaccccgggcagcggcggcgagctgcagctgaccgac
gcggtcgcgctgctgatcagcgagggacacccggtgcacgtcgtcgtccaccgcggcgga
cgccacgacctggggaatccgggtggtttcctgcgcgccgcggtcgatttcgcgcttgaa
acgcccgagtacggtccatctttacgggcgtggctgacggaacggatcgggacagagcgc
ccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system