KEGG   Amycolatopsis mediterranei U32: AMED_8391Help
Entry
AMED_8391         CDS       T01269                                 

Gene name
adh
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AMED_8391 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_8391 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    AMED_8391 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AMED_8391 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMED_8391 (adh)
   00626 Naphthalene degradation
    AMED_8391 (adh)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AMED_8391 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9230123..9231172)
Genome map
AA seq 349 aa AA seqDB search
MVMEEFCVPPVVRNVPEPVAAPGGAVIEVDATGVCRSDWHTWQGHDAAVTLPHVAGHELA
GRIVALGEGVRGWELGARVTVPFVCACGTCAQCARGDQQICDREFQPGATHWGSFAERVA
IEHAETNLVALPDSLGAAEAAALGCRFGTAFRAVLRQGRVTAGQWVSVYGCGGVGISAVL
LAVAAGAKVVAIDVSPAALQLAAKSGAAVTVDSSAFDGPEAVAAHVRELTGGGTYVSLDC
LGSPSTCAASVGSLRKRGRHVQAGLMPPAQGLAPIPMHRVIGGELELVGIHGLQAHEYPE
LLRVVETAGIDLAALIGRRIGLDDVPAALAAMNDPVPAQAGVTVVTFGD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatggaggagttctgcgtcccgcccgtcgtgcggaacgtgccggagccggtggcc
gcgccgggcggcgcggtgatcgaggtcgacgccaccggggtctgccgcagcgactggcac
acctggcaggggcacgacgccgccgtcacgctgccgcacgtcgccgggcacgagctcgcc
ggccggatcgtcgcgctcggcgaaggcgtgcgcggctgggagctcggcgcgcgtgtcacc
gtgcctttcgtctgcgcctgcggcacgtgcgcccagtgcgcccgcggcgaccagcagatc
tgcgaccgcgagttccagcccggcgccacgcactgggggtcgttcgccgagcgcgtcgcc
atcgagcacgcggagacgaacctggtcgcgctgccggactcgctcggcgccgccgaggct
gccgccctcggctgccggttcggcacggcgttccgcgcggtgctgcggcagggccgcgtc
accgcgggtcagtgggtctcggtgtacggctgcggcggcgtcgggatctccgcggtgctg
ctggccgtcgcggcgggcgcgaaggtcgtcgccatcgacgtctcgccggccgcgctccag
cttgccgcgaagtcgggtgccgcggtcacggtcgattcctcggcgttcgacgggcccgaa
gccgtcgccgcgcacgtgcgcgagctgaccggcggcggcacgtacgtctcgctcgactgc
ctcggctcgccgtcgacctgcgcggcctcggtcggcagcctgcgcaagcgcggccggcac
gtccaggccgggctgatgccgcccgcgcagggcctcgctccgatcccgatgcaccgcgtc
atcggcggtgagctggagctggtcggcatccacgggctccaggcccacgagtacccggag
ctgctgcgcgtggtcgagacggcgggcatcgacctcgccgcgctgatcggccggcgcatc
gggctcgacgacgtcccggccgcgctggcggcgatgaacgaccccgtgccggcccaagcg
ggcgtcaccgtcgtgacgttcggtgactga

DBGET integrated database retrieval system