KEGG   Amycolatopsis mediterranei U32: AMED_8692Help
Entry
AMED_8692         CDS       T01269                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:amd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9533364..9534014)
Genome map
AA seq 216 aa AA seqDB search
MILETERAAVCAYARRMVGDGLVVGTSGNVSLRAGDLVAVTPTGVAYSSLTPGDIAVVDL
GGQVVDGLLKPTSELPMHLSVYWDVRDPDGEPVTAVVHTHSPHATAVSTLVRELPPIHYI
VATIGPSVRVARYATYGTPELAAAVLEALEGRRGCLMANHGTLTYGDGLEAAYHRAQQLE
WACRVWLLAQSAGRPSLLPPPEVANVVERLRGYGQG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgagaccgagcgggccgccgtgtgcgcctatgcgcgccggatggtcggtgat
ggcctggtcgtcgggacctccggcaacgtctccctgcgggccggtgatctcgtcgccgtc
acgcccaccggggttgcctactcgagcctcacgcccggcgacatcgccgtcgtcgatctc
ggggggcaggtggtcgatggcttgctcaagccgaccagtgagctgccgatgcacctgtcc
gtgtactgggacgttcgtgacccggacggtgagcccgtcaccgccgtcgtgcacacgcac
tcgccgcacgccaccgccgtctcgacgctcgtgcgtgagcttccgcccatccactacatc
gtcgccaccatcggtccctccgtgcgcgtcgcgcgctacgccacctacggcacgccggag
ctcgctgccgccgtgctggaggcgctcgaagggcgccgggggtgcctgatggccaaccac
ggcaccctcacctacggcgacggcctcgaggccgcctaccaccgcgcccagcagctcgaa
tgggcctgccgcgtgtggctgctcgcgcagagcgccggccggcccagcctgctgccgccg
cccgaggtcgccaacgtcgtcgaacggctgcggggctacgggcagggctag

DBGET integrated database retrieval system