KEGG   Amycolatopsis mediterranei U32: AMED_8744Help
Entry
AMED_8744         CDS       T01269                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9588155..9588646)
Genome map
AA seq 163 aa AA seqDB search
MSRAVLSLGSNLGDRLGFLQSALDAVRPALVSVSSVYETQAWGVEDQPDFLNAVCVVDDP
ARDHWAWLRTGQAAEQAAGRVRELHWGPRTLDVDVVTVDGVTSADPELLLPHPGTPDRAS
VLVPWVEIEPDAILPGHGPIAELLEARPADEVATVRRTDLELR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcgcggtgctgtcgctgggctcgaacctcggcgaccgcctggggttcctccag
tcggcgctcgacgccgttcggccggcgctggtctcggtgtcgagcgtgtacgagacccag
gcgtggggcgtcgaggaccagccggacttcctcaacgcggtgtgcgtggtcgacgacccg
gcgcgcgaccattgggcgtggctgcgcacgggtcaggccgccgagcaggcggcgggccgg
gtgcgcgagctgcactggggcccgcggacgctggacgtcgacgtggtcactgtggacggc
gtgacgtcggcggacccggagctgctgctgccgcacccgggaacgccggaccgcgcgagc
gtgctggtgccctgggtcgagatcgagcccgacgcgatcctgccgggccacggcccgatc
gcggaactgctggaggcccgtccggcggacgaggtggcgactgtccgccggacggacctc
gaactgcgctga

DBGET integrated database retrieval system