KEGG   Amycolatopsis mediterranei U32: AMED_8911Help
Entry
AMED_8911         CDS       T01269                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9764381..9764977)
Genome map
AA seq 198 aa AA seqDB search
MYEGVVQDLIDELGRLPGVGPKSAQRIAFHLLATDPADIARLQDVLGKVKEGVQFCEVCG
NVSEQQKCRICRDERRDLTVICVVEEPKDVLAVERTREFKGRYHVLGGALDPLSGIGPEQ
LRMRELLKRIGEADIKEIIIATDPNTEGEATATYLVRMLRNFPGLSVTRLASGLPMGGDL
EFADELTLGRALSGRRVL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaggtgtcgtccaggacctgatcgacgagctcgggcggctgcccggggtcggg
ccgaagagcgcccagcggatcgcgttccacctgctggccaccgacccggccgacatcgcg
cggctgcaggacgtgctcggcaaggtcaaggagggcgtgcagttctgcgaggtgtgcggc
aacgtctccgagcagcagaagtgccgcatctgccgcgacgagcgccgcgacctcacggtc
atctgcgtggtcgaggagccgaaggatgtcctggccgtcgagcgcacccgcgagttcaag
ggccgctaccacgtcctgggcggcgcgctcgacccgctgtcgggcatcggcccggagcag
ctgcggatgcgcgagctcctcaagcgcatcggcgaggcggacatcaaggagatcatcatc
gccaccgaccccaacaccgagggcgaggcgacggcgacgtacttggtccgcatgctgcgg
aacttcccgggcctgagcgtgacgcggctggcgtcggggctcccgatgggcggtgacctg
gagttcgccgacgagctgacgctgggtcgcgcgctgtcgggtcgccgggtgctctaa

DBGET integrated database retrieval system