KEGG   Amycolatopsis mediterranei U32: AMED_8954Help
Entry
AMED_8954         CDS       T01269                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMED_8954
Enzymes [BR:amd01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     AMED_8954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9810637..9811062)
Genome map
AA seq 141 aa AA seqDB search
MVTGFLKALEDLDIDRALTFAASDIVYQNVPLPPARGVAAVEKQLRLMARFGSGFEARTH
HIASDGNVVLTERTDVLRRGAWEAEFWVCGTFEVEGGRIVLWRDYFDWTTVLAASAKGAG
RVALAGARTLLDRYKGRQAVR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaccggtttcctgaaagcgctcgaagacctcgacatcgaccgcgcgctgacgttc
gcggcgagcgacatcgtgtaccagaacgtgccgttgccgcccgctcgcggcgtcgccgcg
gtcgagaagcagctgcgtctgatggcccgcttcggttccgggttcgaagcgcggacgcac
cacatcgcctcggacggcaacgtcgtgctcaccgaacgcaccgacgtgctgcgccgcggc
gcgtgggaagcggagttctgggtgtgcggcacgttcgaggtcgaaggcggccggatcgtg
ctctggcgcgactacttcgactggacgacggtgctggccgcgagcgcgaagggcgccggg
cgggtcgcgctggccggcgcgcgcacgctcctcgaccggtacaaggggaggcaggcggtg
cgctag

DBGET integrated database retrieval system