KEGG   Amycolatopsis mediterranei U32: AMED_9034Help
Entry
AMED_9034         CDS       T01269                                 

Gene name
purM
Definition
phosphoribosylformylglycinamidine cyclo-ligase
Orthology
K01933  
phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:amd00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9882547..9883617)
Genome map
AA seq 356 aa AA seqDB search
MSESTSATYAAAGVSIDAGDKAVELLKPHAERATRPEVMGGVGGFAGLFSLKLDKWKEPV
LASSTDGVGTKIAVAQALDKHDTVGIDLVAMVVDDLVVTGAEPLFLQDYIAVGKVHPEKI
AALVGGIAEGCVLAGCALLGGETAEHPGLMGEHDYDMSATGVGVVEASQLLSPEKVRPGD
VVLALGSSGLHSNGYSLARHVLLDIARMPLGGYVEEFSRTLGEEMLEPTRIYAKDCLALA
AETEVRTFAHITGGGLEANLARVMPRGLVARLDRGTWTPAPVFAVIGQRGKVERSELEKT
FNMGVGMVAIVGAEDVDRALAMLTARHVPAWVLGDVQPAEDVDGPRAVLSGDHPRF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagtccacgagcgccacgtacgccgccgccggcgtcagcatcgacgccggcgac
aaagccgtcgagctgctcaagccgcacgccgagcgggcgacgcggcccgaggtcatgggt
ggcgtcggcggtttcgccgggctcttctccctgaagctcgacaagtggaaggagccggtg
ctcgcgtcgtccaccgacggcgtcggcacgaagatcgcggtcgcgcaggcgctcgacaag
cacgacaccgtcggcatcgacctggtcgcgatggtggtcgacgacctggtcgtgaccggt
gccgagccgctgttcctgcaggactacatcgccgtcggcaaggtgcacccggagaagatc
gccgcgctggtcggtggcatcgccgagggctgcgtcctggccggctgcgcgctgctcggc
ggcgagaccgcggagcacccgggcctgatgggtgagcacgactacgacatgtcggccacc
ggcgtcggcgtcgtcgaggcgtcgcagctgctctcgccggagaaggtccgtccgggtgac
gtcgtgctggctctcggttcgtcgggcctgcactcgaacggctactcgctggcccggcac
gtgctgctggacatcgcccggatgccgctcggcgggtacgtcgaggagttcagccgcacc
ctcggcgaggagatgctggagccgacgcggatctacgcgaaggactgcctcgcgctcgcc
gcggagaccgaggtccggacgttcgcgcacatcaccggcggcggcctggaagccaacctc
gcccgggtcatgccgcgcggcctggtcgcccggctcgaccgcggcacctggacgccggcg
ccggtgttcgcggtgatcggccagcgcggcaaggtcgagcgcagcgagctggagaagacg
ttcaacatgggggtcggcatggtcgcgatcgtcggcgccgaagacgtcgaccgggcgctg
gccatgctgaccgcgcggcacgtcccggcgtgggtgctgggcgacgtccagcccgccgaa
gacgtcgacggcccgcgcgcggtgctctcgggtgatcacccccgcttctga

DBGET integrated database retrieval system