KEGG   Amycolatopsis mediterranei U32: AMED_9092Help
Entry
AMED_9092         CDS       T01269                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMED_9092 (rbsK)
Enzymes [BR:amd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AMED_9092 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9941091..9942563
Genome map
AA seq 490 aa AA seqDB search
MAKPDAAVEGVRNVFLKLRTRSGLNVERLSATEVDVVLLADLPVVRRYAREHNVSTEQAI
VDVVTRVTADLEPTDRLITDAVLALGVLDDLLAGQPTLRGLYAEDLGDRRNALAQHWEAY
HRLLGVTEIPPAPTVRTLRGSVEARALVRLAERCVRGPEAPLLEPAADSREPSNSIVVVG
GAVTDVVVVSDKLPGIGAAVQATSFEEHPGGKGLNLAVAAKRFGLRARLCAAIGGDEAAR
ELTRYMQQEGLSTELIRETSGEANPRALMLVTQRGETRYLGWMNKGKVSLSTTEFELPRT
KRAIADADAVLITLEPPVETVQWALDTAARQSPKPLVLLQASPPVETPQQLYRHLHGVDY
LVGREGELRGLLSYPDRPATVDALAEELLTLGVETVCVVENFGAKIRSRTRSRDIEGPNV
PLEDTPGAREAFSAALTFQLLQDGGDLTWDALEWAIQAMTVNLTLEEITNSMPGTEDVER
LWRKPDVENP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccgacgccgccgtcgagggcgtccgaaacgtctttctcaagctacgcacc
cgcagcggcctcaacgtcgagcggctcagcgcgaccgaggtcgacgtcgtgctgctcgcc
gacctgcctgtcgtgcgccggtacgcgcgtgagcacaacgtgtccaccgagcaggccatc
gtcgacgtcgtcacccgggtcaccgccgatctcgaaccgaccgaccggctgatcaccgac
gcggtgctcgccctcggcgtgctcgacgacctgctcgccggccagccgacgctgcgcggg
ctgtacgcggaggacctcggcgatcgacgcaatgcgctggcccagcactgggaggcgtac
caccgcctgctcggcgtgaccgagattccgccggcgccgaccgtgcgcaccctgcgcggc
tcggtcgaggcacgcgcgctcgtccggctggcggagcgctgcgtgcgcgggccggaagcg
ccgctgctggagccggccgccgattcccgtgagcccagcaactcgatcgtcgtggtcggg
ggtgcggtgacggacgtggtcgtggtctccgacaagctgcccgggatcggggccgcggtg
caggcgacctcgttcgaggagcaccccgggggcaagggactcaacctcgcggtcgcagcc
aagcggttcggcctccgcgcgcggctgtgcgccgccatcgggggtgacgaggccgcccgg
gaactcacccgctacatgcagcaagaaggtttgtcgaccgagctgatccgggagacgtcg
ggcgaggcgaatccgcgggctttgatgctcgtgacacagcggggtgagacgcgatacctg
ggctggatgaacaaaggcaaggtctcgctgtccaccacggaattcgaactaccgcgcacg
aaacgagcaatagccgacgccgatgcggtgttgatcaccttggaacccccggtggaaacg
gtgcagtgggcgctcgacacggccgccaggcaatcgccgaaaccgttggtcctgttgcag
gcttcgccacccgtggaaacgccgcaacagctttaccggcatcttcacggcgtcgattac
ctcgtcggccgtgaaggcgaactgcgcgggctgctgtcctatccggaccgccccgccacg
gtcgacgcgctggctgaggaactgctcaccctcggcgtggagacggtctgcgtggtcgag
aacttcggcgccaaaatccggtcccggacgcggtccagggacatcgaaggcccgaacgtc
ccgctcgaagacactcccggggcccgggaagccttttccgcggctctgactttccagctc
ctccaggacggcggggacctgacctgggacgccctcgaatgggcgatccaggccatgacc
gtcaacctcacgctcgaggagatcaccaactccatgcccggcaccgaagacgtggaacgg
ctgtggaggaaacctgacgtggagaacccgtga

DBGET integrated database retrieval system