KEGG   Apis mellifera (honey bee): 100576866Help
Entry
100576866         CDS       T01057                                 

Definition
probable elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100576866
Transfer RNA biogenesis [BR:ame03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100576866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 551 aa AA seqDB search
MVKKRKEFEQSKEERMVMTIGEIIQELLKAHEENRDVDLNKLKTRIASKYGLETSPRLVD
IIAAVPVDARNILIPKLKAKPIRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYNPFLQTRHRVEQLKQLGHNVDKIEFIVMGGTFMSLPE
DYRDYFIRNLHDALSGHVSSNVDEAVKFSERSRTKCIGITIETRPDYCLKKHLSDMLRYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVCESFQLSKDAGFKVIAHMMPDLPNVDIERDVN
QFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPSVLVDLIARILSLIPPW
TRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTDCRDVRTREVGIQEIHQKVQPYE
VELIRRDYIANGGWETFLSYEDPTQDILVGLLRLRKCSNETFRSELKEKCSIVRELHVYG
SVVPVNARDPTKFQHQGFGMLLMEEAERIAKEEHGSHKISVISGVGTRNYYRKMGYELDG
PYMSKILVLCK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaaagaaaagaatttgaacaaagcaaagaagaacgtatggttatgacaatt
ggagaaattatacaagaattattaaaagcacatgaagaaaatagagatgttgatttaaat
aaattaaaaacacgaattgcttctaaatatgggttagaaacttcaccaagattggttgac
attatagcagctgttcctgttgatgcaagaaatatattaataccaaaattaaaagcaaaa
cctattaggactgctagtggaatagctgttgtagctgtaatgtgtaaacctcatcgatgc
cctcatattaatatgacaggaaatatttgtgtatattgtcctggtggacctgattctgat
tttgaatattctacacaatcttatactggttatgaacctacatctatgagagctattcgt
gcaagatataatccatttttacaaactaggcatcgtgtagaacaattaaaacaattggga
cataatgtagacaaaattgaatttattgttatgggaggtactttcatgtctctgccagaa
gattacagagattattttattcgaaatttacatgatgctctttctggtcatgtaagtagc
aatgttgatgaagcagtaaaattttctgaacgaagtcgtacaaaatgtattggtattact
atagaaacacgtcctgattattgtcttaagaaacatctttctgatatgttacgttatggg
tgtactcgtttagaaattggagttcaatctgtatatgaagatgtagcacgagatactaat
agaggacatacagttcgtgcagtatgcgaaagttttcaattatcaaaagatgctggtttc
aaagtaatagcacatatgatgccagacttaccaaatgttgatattgagagagatgtaaat
caattcattgaattctttgaaaatcctgctttcagagcagatggattgaaaatttatcca
acattagttatacgaggtacaggtttatatgaattatggaaaacaggaagatataaaagc
tatccaccgagtgttttagtagatcttattgctcgaatattgtctttaataccgccttgg
actcgtgtatatcgtgtacagagagatatacctatgcctttagttagctcgggtgtggaa
catggaaatttacgtgaattggcattagcaagaatgaaagatttgggaactgattgtcgc
gatgttagaactcgggaagtgggtattcaagaaatacatcagaaagtacagccttatgaa
gtagaacttatacgccgtgattatattgccaatggtgggtgggaaacatttttatcctat
gaagatcccactcaagatattttagttggtttactaagacttagaaaatgttcaaatgaa
acatttaggtcagaacttaaagaaaaatgttcaatagtgagagaacttcatgtatatggt
agtgttgttccagtgaatgcccgtgatcctacaaagtttcagcatcaaggatttggaatg
ttattaatggaagaagctgaacggatagcaaaggaagaacatggatctcataaaatttct
gttatatcaggtgttggaacaaggaattattatcgaaaaatgggatacgaacttgatggt
ccatatatgtctaaaatacttgtactttgtaaataa

DBGET integrated database retrieval system