KEGG   Apis mellifera (honey bee): 100577120Help
Entry
100577120         CDS       T01057                                 

Definition
uncharacterized LOC100577120
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100577120
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100577120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG3
AA seq 837 aa AA seqDB search
MSDLSTNDRLMLNNMDFQNHTNSRPKFQPIRVKELLHFCESDDDESEDKPQDSDIESDFD
DPQPLPQDDHVEHDSIQSLSLLNVTSNKLKETCKESISFNNIIECEPKIKSTFHEYEHNM
TNENMKCEHSNQMQLNIQTIAQEKLSQTEHKNKYITNIEIKEEIKEQLTQDQFLDQQTSC
KVNNNTESIASTFQYFEKVPQFGMHNLQNINCKKEALESVEEKLASIASEEKIHHENVSS
KGKSLISDTGTFVNSTDQWLQTPLKHASNSIHPDPCFSRRNIIQTPQNKLSDPTSKDHGL
ALTVSSHWSQNNIKQTPLQNKNINFKDSMQTPKNSFYFTSSIGKNETPRYFDTGGKLRKP
LADTGSFIQNDAYNRHLLQGSQFPKVNEETPKIQNKSSCENLNKTDLSKEIFDTSENVEH
LELKEKKYNQSKKDKLSDKETINKISNKHVPHCIKNNKEIIKSVYQNQHSEVSNQNQHQE
FKKVIDNPLNLQFSMPSNIPKSRQNRTLFVKGKEYLILGTLGQGMSGEVLRAQDLSSLEL
CAIKCVNLNRMDKDSAQGCLEEISMLHKLQAPCVVKMFDYEIKYPMVYVVMEMGDTDLSR
LLKTTSQEKQIPLTMILYYWTEMLTAVKHIHDNGVIHSDLKPANFLLVRGRLKLIDFGIA
SSMNADMTSVVKNCPIGTLNYISPEALMDIGGNSDSPTQNVKYKISFKSDVWSLGCILYS
LVYGHTPFHHIRSQWAKVNAITNPNLNIPFPKTLSEDGNKITFSPPILIDVMRKCLQHNP
KARPTVAELLEVEYIMTTGEHTSITPPEIPANILVKIKHTLNEDEWRQLTWILENRR
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttatcaacaaatgacaggcttatgttaaataacatggattttcaaaatcat
accaattcacgtccaaaatttcaaccaatacgagtaaaagaattattacatttttgtgaa
agcgatgatgatgaaagtgaggataaaccacaagattctgatattgaatcagattttgat
gatcctcaacctttaccacaagatgatcatgttgaacatgattcaattcaatcattatct
ttgcttaatgtaacatctaataagttaaaagaaacttgtaaagaatccatatcatttaat
aatattatagaatgtgagcctaaaattaagtcaacatttcatgaatatgaacataatatg
acaaatgaaaatatgaaatgtgaacattcaaatcaaatgcaattaaatattcaaactatt
gcacaagaaaaactttcacaaactgaacacaaaaataagtacattactaatatagaaatt
aaagaagaaattaaagaacaattgactcaggatcaatttttagaccaacaaacttcttgt
aaagtgaacaataatactgaatctattgcttctacatttcaatattttgaaaaggtacca
caatttggaatgcataatttgcagaatataaattgcaaaaaggaagcattagaatcagta
gaagaaaaattagcatccatagcaagtgaagaaaaaattcatcatgaaaatgtatcttcc
aagggtaaatcattaatatcagatacaggaacatttgtaaattctactgatcaatggtta
caaactcctttaaaacatgcatctaattctatacatccagatccatgtttttctcgtaga
aatattattcaaactccacaaaacaaattatcagatccaacatctaaagatcatggatta
gctttaactgtttcatctcattggtctcaaaataatataaaacaaactccattacagaac
aaaaatattaatttcaaagattctatgcaaactccaaaaaattctttttactttacatca
agcataggaaagaatgaaactccaagatatttcgatacaggaggtaaattaagaaaacct
ttagcagacacaggaagttttatacaaaatgatgcttataatagacatttattacaagga
tctcaatttcctaaggtaaatgaagaaacacctaaaattcaaaataaatcatcatgtgaa
aatttaaataaaacagatttgtcaaaagaaatatttgatacatcagaaaatgttgaacat
ctggaattaaaagaaaaaaaatataatcaaagtaaaaaggataagttatcagataaagaa
acaataaataaaatatcaaataaacatgttccacattgtatcaaaaataataaagaaatt
ataaaatcagtatatcagaatcaacattcagaagttagtaatcaaaatcaacatcaagaa
tttaaaaaagttatagataatccgttaaatttacaattttcaatgccatctaatattcca
aaatctaggcaaaatagaactctttttgttaaaggaaaagagtatttaattttgggtaca
cttggtcaaggtatgagtggagaagttttaagagcacaagatttatcttctcttgagtta
tgtgctattaaatgtgttaatcttaatcgtatggataaggactcagcacaaggttgctta
gaagaaatttcaatgttacataaattacaagcaccatgtgttgttaaaatgtttgattat
gaaattaaatatccaatggtatatgtagtaatggaaatgggtgatactgatctcagtcgt
cttttaaaaacaacatctcaagaaaaacaaattcctcttacaatgattttatattattgg
acagaaatgttaacagctgttaagcatatacatgataatggagtaattcattctgattta
aaaccagcaaattttttattagtacggggacgattgaaacttatagattttggaattgct
tctagtatgaatgctgatatgacatctgttgtaaaaaattgtccaataggaactttaaat
tatattagtccagaagcattaatggatattggtggaaattcagattctcctacacagaat
gttaaatataaaataagttttaaatcagatgtatggtctttaggatgtattttgtatagt
ttagtatatggtcatacaccatttcatcatattcgatcacaatgggctaaagtaaatgct
ataaccaatccaaacttgaatattccttttcctaaaactctgtcagaagatggtaataaa
attacattttcaccaccaattttaattgatgtaatgcgaaaatgtcttcaacataatcca
aaagcacgcccaacagtagctgaacttttggaagtagaatatattatgactacaggagaa
catacttcaataacacctcctgaaattccagcaaatattttagtgaaaataaagcataca
ttaaatgaagacgaatggcggcaattaacatggattttggagaatagaagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system