KEGG   Apis mellifera (honey bee): 100577330Help
Entry
100577330         CDS       T01057                                 

Definition
probable histone-lysine N-methyltransferase NSD2-like
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
ame  Apis mellifera (honey bee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100577330
Enzymes [BR:ame01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100577330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG9
AA seq 1394 aa AA seqDB search
MNTINKVNSKVGIIVESRFGEFDKNLETTSNNFENDQMDISVNCNKTSPGRSRYGRIIKP
KSPKNEVASSPKNSKMPKNRKYQNSFDSSNDSTDENNTTNDMDDTSDSSNSLSIMEETTP
KLVGSPIQCNWILGQLAWARVGNFPFWPCVITLDPVLMVYHRLKATARSQILMIHVQYFG
DKGRHSWVSSNSMIPFTNLADFKKLSESITAEVKKRDAKYAAAFIVKPGIKSKWESAIEE
AMEVQPMSNDDRANIFKPKEKNIKNKSSKISEEKDKVNKRKHSSDSNGPDLKRTKQDNVC
ELHKSLQDKTDGTKSNILKYIENGKNHSKLNSDTPPLSPLSQRDSNDEVSLMQKVEFRTE
EDIDGVFEVYYERNRDMLEDEYPDASEHDIRKYLRKTWDNMNSSFRKKYRSYVTSDTSNV
HAKENSLDQEDDLLIEIDGNTKDNKKSKIKVEKEEINISETKKNRPYNLFKGMKQEKVCQ
ICEKTGKLTRCKGPCYSYFHLSCVKPGESSPEHSIDENIMDDKILDDIKEIKQNNIDDDE
NNGKSEEQEDEFFKCIDCLSGVAPACFICNEREGDRIRCSVLACGKHYHSSCLKSWPQSH
WQGGRLTCPYHICHTCSSDNPQDSHSRAPNEKLARCVRCPSSYHTSTSCLPAGSVILTGS
QIVCPKHYQPPQPPVNAAWCFSLXESGSLICCDTCPTSFHLECLGINAPDGAFICEDCET
GRLPLYGEVVWVKLGNYRWWPSRICYPHEIPENIEAIAHSPGKFCVMFLGSNNYHWIHRG
RAFLYQDGDANIKPPIGKKNRDDTYRKALEEANEIHQRLKIERAAAKDHGPRGLKPPHYV
KLKVNKPVGNVKPVEVESIVACDCDPEWENPCAPGTDCLNRILLVECSPGICPAGPKCNN
QAFVRRQYPAMEPFHTIGRGWGLRSLEHIKAGQFVIEYVGEVIDEAEYKRRLHRKKELKN
ENFYFLTIDNNRTIDAEPKGNLSRFMNHSCSPNCETQKWTVNGDTRIGLFALCDIEPGEE
LTFNYNLACDGETRKPCLCGASNCSGFIGLKVQKPQITTPSIQQKKIEKFDKIKRQKRSR
KHVLCWSCGQEIEKLAEFVICDQKTCNKKYHKTCVIIDDTDSRFSCPWHRCAECRRRTSA
HCSFCSAAFCQGKHFNSTKKIEKFDKIKRQKRSRKHVLCWSCGQEIEKLAEFVICDQKTC
NKKYHKTCVIIDDTDSRFSCPWHRCAECRRRTSAHCSFCSAAFCQVHLDGNLFEYSEKGG
FVCKLHENMDMQRSSVEDEKDYSDNDTETDKEYSSTGSNSPLLTMEKSIPREPSPRVSIV
EVHPSSEESEESQKEDDEEAIQFADFMPCDSKNMKRKELHRLSLRLKGGKDQVEKLSNLT
SSQLEAIIGGSLLE
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatcaacaaagtaaatagcaaggtgggcataattgttgaatcaagatttggc
gaattcgacaaaaatttggaaacaacgagcaacaattttgagaatgatcaaatggacatc
agtgttaattgtaacaaaacttcacctggtagaagtcgttatggcagaataataaaacct
aagtctcctaagaatgaggttgccagttctccaaagaattctaaaatgccaaagaatcga
aaatatcaaaattcatttgatagtagtaatgatagtactgatgaaaataatacaactaat
gatatggacgatacaagtgattcttctaatagtttaagtatcatggaagaaactactcca
aaattagttggttcacctatacaatgtaattggattttaggtcaattagcatgggccaga
gttggtaattttcctttttggccttgtgttataacacttgatccagttttaatggtatat
cataggttaaaagctactgccagatcacaaatactaatgatacatgtccaatactttggt
gataaaggacgtcatagttgggtttcatcaaattctatgataccatttacaaatcttgca
gactttaaaaaattatcagaatcaatcactgcagaagttaaaaaaagagatgcaaaatat
gcagcagcatttattgtaaaacctggtataaaatcaaaatgggaaagtgcgattgaagaa
gctatggaagttcagcctatgagtaatgatgacagagcaaatatttttaagccaaaggaa
aaaaatataaaaaataaatcatcaaaaatatctgaagaaaaggataaagttaataaaaga
aaacactcaagtgattcaaatggtcctgatcttaaacgtactaaacaagataatgtatgt
gagttacacaaatcattacaagacaaaacagatggtacaaaatcaaatatactcaaatac
attgagaatggtaagaatcattcaaaactcaattcagatactcctccattatctccttta
agtcaaagagattcaaatgatgaagtttctctcatgcaaaaagttgaatttcgaactgaa
gaagatatagatggtgtctttgaggtttattatgaacgaaatagagatatgttagaagat
gaatatccggatgcatcagaacatgatatcagaaaatatttaagaaagacttgggataat
atgaattcttcttttcgcaaaaagtaccgatcgtatgtaacttcagacacttctaatgtt
catgcaaaagaaaattcgttagatcaggaagatgatttattgatagaaatagatggaaat
actaaagataataaaaaatctaaaatcaaagttgaaaaagaagagataaatatttcagaa
acgaagaaaaatagaccttataatctttttaaaggaatgaaacaagagaaagtttgtcaa
atatgcgaaaaaactggaaaattaactaggtgtaaaggtccttgttattcgtattttcat
ctttcttgtgtcaaaccaggagaatctagtccagaacattccattgatgagaatatcatg
gatgataagattcttgatgatataaaggagattaaacaaaataatattgatgatgatgag
aataatggcaaatcagaagaacaagaagatgagttctttaaatgtattgattgtttatca
ggagtagcacctgcttgttttatatgtaatgaaagagaaggagatagaataagatgttct
gtattagcttgtggaaaacattatcattcatcttgcttaaaatcatggccacaatctcat
tggcaaggaggccgtttgacttgtccgtatcacatatgtcatacatgcagttcagacaat
cctcaggatagtcattcaagagctccaaatgagaaattggcacgatgtgttcgttgtcct
tcgtcttatcatacatctacatcttgtttacctgctggttcagtgattttaactggtagt
caaatagtttgtccaaagcattatcaaccaccacaacctccagtaaatgcagcatggtgt
ttttctctctgagagagtggaagtctaatttgttgtgatacatgtccaacatcatttcat
ttagaatgtttaggtatcaatgctcctgatggtgcatttatttgtgaagattgtgaaaca
ggtagattgcctttatatggagaagttgtttgggttaaacttggtaattatcgttggtgg
ccatctcgtatttgttatcctcatgaaattcctgaaaatatagaagctatagcacatagt
cctggtaaattttgcgtaatgttcttaggatcgaataattatcattggattcatagagga
cgtgcttttttgtatcaagatggtgatgcaaatataaaaccaccaatcggtaaaaaaaac
cgagatgatacttatcgtaaggcattagaagaagccaatgagattcatcaacgtttaaaa
attgaaagagctgccgctaaagaccatggaccacgtggattgaaacctccacattatgtt
aaattaaaggtgaataaaccagttggtaatgtaaagccagtagaagttgaaagtattgtt
gcatgtgattgtgatccagaatgggaaaacccatgtgcaccaggaacagattgtcttaat
cgaatattattagttgaatgtagccctggcatttgtccagctggtcccaaatgtaacaat
caagcatttgtacgaagacaatatccagctatggaaccatttcatactataggacgtggt
tggggtcttagaagtttagaacacattaaagctggacagtttgttatagaatatgtaggt
gaagttatagatgaggctgaatacaaacgaagactacatagaaaaaaggaattaaaaaat
gagaatttttattttctaactatagataataatagaacaatcgatgcagaaccaaaaggc
aatcttagtcgatttatgaatcattcgtgttcacctaattgtgaaactcaaaagtggaca
gtaaatggagatacacgtataggtctgtttgcattatgcgatattgagcctggcgaagaa
ttgacttttaattataatttagcttgtgatggagaaactcgaaagccttgtttatgtggt
gcatcaaattgtagtggatttataggtttaaaagtgcagaaaccgcaaataacaacacct
tcaattcaacaaaaaaaaattgaaaaatttgataaaataaaacgtcaaaaaagatcgaga
aagcatgtattatgctggagttgtggacaagaaattgaaaaattagcagaatttgtcatt
tgtgatcaaaagacatgtaataagaaataccataaaacttgtgtaatcattgatgataca
gattcaagatttagttgtccttggcatcgctgtgcagaatgtcgccgtagaacatctgca
cattgttccttctgtagtgctgctttttgtcaaggtaaacacttcaattcaacaaaaaaa
attgaaaaatttgataaaataaaacgtcaaaaaagatcgagaaagcatgtattatgctgg
agttgtggacaagaaattgaaaaattagcagaatttgtcatttgtgatcaaaagacatgt
aataagaaataccataaaacttgtgtaatcattgatgatacagattcaagatttagttgt
ccttggcatcgctgtgcagaatgtcgccgtagaacatctgcacattgttccttctgtagt
gctgctttttgtcaagtgcatctggatggaaatctatttgagtacagtgaaaagggtggt
tttgtctgtaaactgcatgaaaatatggatatgcagagatcttctgtagaagatgaaaaa
gattattcggataatgatactgaaacagacaaagaatactcgtctacaggttccaatagt
ccgttattaacaatggaaaaatcaataccaagagaaccatcaccaagagtttccatagtg
gaggttcatccaagtagtgaagaaagtgaagaatctcaaaaagaagacgacgaagaagca
atacagtttgctgattttatgccttgtgattcaaaaaatatgaaacgaaaagaattacac
cgattatctctaagattgaaaggagggaaagatcaggtagaaaaattaagtaatcttaca
tctagtcaattggaggctataatcggtggcagtctacttgagtga

DBGET integrated database retrieval system