KEGG   Apis mellifera (honey bee): 102656812Help
Entry
102656812         CDS       T01057                                 

Definition
polyprenol reductase-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102656812
    1.3.1.94  polyprenol reductase
     102656812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG1
AA seq 302 aa AA seqDB search
MQINIIRILFIFCTIFTGILGLLIYRMESYLPIFLTRTYRYGKYSVNIYEPIIAKTEVPR
KWFKHFYIFAAPASSYVLYLVICIYLWEYDISKNIMWILDICLGSFRQPLVSSESTFIAI
LLLTFHCWKRLYETYYVNIFSDKKMNILHYLIGFYHYIGTLICIISESEGFVKGSKGNFS
WNKITYFHLLCSIIFILSTYAQLKSNFILRKLRKNKDGKINSTIYKIPHDGLFEYVSGAL
QITEIIIYITLSIILWQSSTFHYVTIWVLCNQIWTATLTHQWYIQTFKNYPKSRKILIPF
IF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaatattatacgtattttatttattttttgtacgatattcactggtattctt
ggattattaatctatcgtatggaatcttatttacctatttttttaactcgtacttatcgt
tatggtaaatattctgttaatatttatgaaccaataattgcaaaaacagaagtacccaga
aaatggtttaaacatttttacatttttgctgcaccagcttcaagttatgtactatactta
gttatttgtatatatttatgggagtatgatatttccaaaaatattatgtggatattagat
atatgtctgggatcatttagacaaccactagtatcatcagaaagtacatttatagcaatt
ctacttttaacttttcattgttggaaacgattatatgaaacatattatgtaaatatcttc
agtgataagaaaatgaatatacttcattatttaattggattttatcattatataggaacc
ttaatatgtattataagtgaatctgaaggctttgttaaaggttcaaaaggaaatttttct
tggaataaaattacatattttcatttattatgttcaattatttttatattatcaacatat
gcacaacttaagtcaaattttattcttcgtaaattacgaaaaaataaagatggaaagatt
aattctacaatatataaaataccacatgatggtctgtttgaatatgtatcaggtgcatta
caaattacagagataattatttatataacactttctataattttatggcaaagttctaca
tttcattatgttacaatttgggtcttatgcaaccagatatggactgcaacattgactcat
caatggtacatacaaacatttaaaaattacccaaaatctcgaaaaattttaattcctttt
attttttaa

DBGET integrated database retrieval system