KEGG   Apis mellifera (honey bee): 406092Help
Entry
406092            CDS       T01057                                 

Gene name
For, GB18394
Definition
cGMP-dependent protein kinase foraging
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
ame  Apis mellifera (honey bee)
Module
cGMP signaling
Brite
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     406092 (For)
Protein kinases [BR:ame01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   406092 (For)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG13
AA seq 678 aa AA seqDB search
MGTLRELQELLRVKDEKIVELEALLCRRDAEIQELRSHLDKFLQCASLKLAFEPRRNPGP
GSKGPRDFPRSHRFKSLPRCQLSNKRDRSRELIKAAILANDFMKNLELTQIRRDRGLHVS
CSFSAGSTIIREGDVGSIVYVMEEGKVEVSRDGKYLSTLAPGKVLGELAILYNCKRTATI
TAATDCQLWAIDRQCFQTIMMRTGLSRQAEYTDFLKSVPIFKNLPEETLIKISDVLEETF
YNNGDYIIRQGARGDTFFIISRGQVRVTIKQPDTPEEKYIRTLSKGDFFGEKALQGDDLR
TANIIADDPEGVSCLVIDRETFNQLISSLDEIRTRYKDSSSSVEGWENRATIPELNEEFR
DLRLQDLRPLATLGVGGFGRVELVQIAGDSSRSFALKQMKKAQIVETRQQQHIMSEKRIM
GEADCDFVVKLFKTFKDRKYLYMLMEACLGGELWTVLRDKGHFDDGTTRFYTACVVEAFD
YLHSRNIIYRDLKPENLLLDSQGYVKLVDFGFAKRLDHGRKTWTFCGTPEYVAPEVILNK
GHDISADYWSLGVLMFELLTGTPPFTGGDPMKTYNIILKGIDAIEFPRSITRNATALIKK
LCRDNPAERLGYQKGGISEIQKHKWFDGFNWEGLRARTLEPPIMPRVQNATDTTNFDEYP
PDSDPPPPDDISGWDNDF
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgggcacccttcgagagctgcaggagttgctgcgtgtcaaggacgagaaaatcgtcgag
ctcgaggcgcttctctgccgtcgcgatgccgagatacaagagttacgaagccatctcgac
aagtttcttcagtgtgcttcccttaaattggcctttgaaccccgacgaaacccaggccca
ggaagcaaagggcccagggattttccgcggagccaccgcttcaagagcttgccccgctgc
caattgtcgaacaagagggacagatctcgtgaactgatcaaagcagccattttggccaat
gacttcatgaagaacctcgagctgacgcagatccgaagagatcgtggattgcatgtatcc
tgttccttctcggctggttcaaccatcatacgtgaaggagatgttggttccattgtgtat
gttatggaggaggggaaggtcgaggtgtcgcgtgatggtaaatatttgagcacgttggca
ccaggaaaggtacttggcgaactggcaattctctacaactgcaaaagaacagctacgata
acagcggctaccgattgccagctatgggccatcgaccgacaatgcttccaaaccattatg
atgagaactggcctttcacggcaggccgaatacacggatttcttaaagagcgttcctatc
ttcaagaatttgcccgaggagactctaataaaaatttcagacgtattggaagagactttt
tacaacaatggggattacataatcaggcaaggagcgagaggagacacatttttcataata
agcagaggacaagtccgcgtcacgataaaacagcccgatacaccggaggagaaatatatc
aggaccctaagcaaaggcgatttcttcggtgaaaaagctcttcaaggggatgacctgagg
acggccaacataatcgccgacgatccggaaggagtgagttgcctggtgatagaccgtgaa
acgttcaatcagctaatctcgtccctggacgaaattcgtacacgatacaaagacagctcg
tcgagcgtagaaggatgggagaatagagcgacaataccagagttgaacgaggaattcaga
gatctaagactgcaagatcttcgaccattggccactcttggtgtgggcggtttcggaaga
gtcgaattagttcaaatagctggcgacagttcgagatcattcgctttgaaacagatgaag
aaagcccagattgttgagacgcgacagcaacaacacattatgtcagagaagagaattatg
ggggaagctgattgcgatttcgtggtaaagttgttcaaaacgttcaaggataggaagtat
ctttacatgctgatggaagcctgtcttggtggcgagctttggaccgttctaagagacaag
ggtcactttgacgacggcacgacaagattctacaccgcttgcgtcgtagaggcattcgat
tatcttcattctaggaatattatatacagagatctcaagccggaaaatctcttgcttgac
agtcaaggatatgtaaaactcgtcgattttggttttgccaaacgtttggatcacggaaga
aagacgtggaccttctgcggcacgcctgaatacgttgcaccggaagttatattgaataaa
ggacacgatatcagtgccgattattggtctcttggtgttctgatgttcgaacttctcact
ggtacaccaccgttcaccggtggcgacccgatgaagacttataacattattttaaaagga
atcgacgctatagaattccctagatctatcacgcgaaacgcgactgcgttaattaaaaag
ctctgcagggacaacccagcagaacgtcttggttaccaaaagggtggaattagcgaaata
cagaaacacaaatggttcgatggttttaattgggaaggtttaagagcaagaacccttgaa
cctccgatcatgccgcgagttcaaaatgctacagacacaacgaactttgacgagtatcct
ccagattcagatccaccaccacctgatgatatatccggatgggataacgatttttag

DBGET integrated database retrieval system