KEGG   Apis mellifera (honey bee): 406104Help
Entry
406104            CDS       T01057                                 

Gene name
AChE-2, ACE2, Ache, GB14873
Definition
acetylcholinesterase 2 (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    406104 (AChE-2)
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     406104 (AChE-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG8
AA seq 628 aa AA seqDB search
MTTRILLLFFLLLSSCTRPSRGNAVPSSQRGNVHNDPLVVETTSGLVRGFPRTVLDKEVH
VFYGIPFAKPPIGPLRFRKPLPIEPWHGVLNATVLPNSCYQERYEYFPGFPGEEMWNPNT
NISEDCLYLNIWVPQKYRLRHKGDGSPGGNGGPRNGLLPLLVWIYGGGFMSGTATLDVYN
ADIMAATSNVIIASMQYRVGAFGFLYLNKHFTNSEEAPGNMGLWDQALALRWLRDNAEAF
GGDPELITIFGESAGGSSVSLHLISPVTRGLVRRGILQSGTLNAPWSYMSGEKANEVATI
LVDDCGCNSTMLNENPARVMACMRSVDAKTISVQQWNSYWGILGFPSAPTIDGIFLPKHP
LDLLREADFKDTEILIGNNENEGTYFILYDFNDIFEKDQASFLERERFLGIINNIFKNMS
QIEREAITFQYTDWEEVYNGYIYQKMVADVVGDYFFICPSIHFAQLFADRGMKVYYYFFT
QRTSTNLWGEWMGVLHGDEVEYVFGHPLNKSLKYSDKERDLSLRMILYFSEFAYLGKPTK
EDSEWPSYSRDEPKYFIFDAEKTGLGKGPRTTYCAFWNEFLPKLKGIPDPXPNTCKVIAS
SVSAGEEGLGNSLAITALSSILVLSRVI
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgactacgaggatcctactcctgttcttcctccttctctcctcgtgcacgcgtcctagc
aggggcaacgcagttccctcctcgcagaggggcaacgtgcacaacgaccccctggtcgtg
gagacgaccagcggcctcgtgcgcggtttcccccgcaccgtgttggacaaggaggtgcac
gtgttctacgggataccgttcgccaaacccccgatcggccccctccgtttcaggaaaccg
ttgccgatcgagccgtggcacggcgtgttgaacgcgaccgtgttgccgaacagttgctac
caggagagatacgagtatttccccgggttcccgggcgaggagatgtggaacccgaacacc
aacatatccgaggactgtttgtacctgaacatatgggtgccacagaagtatagattgagg
cacaagggagacggttcgccgggtggcaacgggggtcccaggaacggtttgctcccttta
ctggtgtggatctacgggggtgggttcatgagcggcacggcaaccctggacgtgtacaac
gcggacataatggcggctacgagcaacgttataatagcatcgatgcagtacagggtgggc
gcgttcggtttcctctatctgaacaaacacttcacgaacagcgaggaggcgccggggaac
atgggtctttgggatcaggcgctcgcgcttagatggctgagggacaacgccgaggcgttc
ggcggggatccggagttgatcacgatattcggcgagtcggcggggggcagctccgtctcc
ctgcacctcatctcgcccgtgacgaggggactggtgcgccgcggcatactgcagagcggc
accctcaacgctccctggagttacatgagcggggagaaggcgaacgaggtcgcgacgata
ctggtcgacgattgcggatgcaactcgaccatgctgaacgagaacccggccagggtgatg
gcgtgtatgaggtccgtggacgcgaagaccatatccgttcaacagtggaacagttattgg
gggattctaggcttcccctcggcgcccaccatcgacggtatcttccttcccaagcatcct
ctcgatctgttgagggaagcggacttcaaggacacagagatactgatcggtaacaacgag
aacgagggaacttatttcatcctttacgacttcaacgatattttcgagaaggaccaggcc
agtttcttggaacgagaaagattccttggtattattaacaacatcttcaagaacatgtct
caaattgaacgagaagccattactttccagtacacggactgggaggaggtgtacaacggg
tatatttaccaaaaaatggtcgcggacgtggttggcgactacttcttcatctgtccctcg
atccacttcgcccaattgttcgccgatcgtggcatgaaggtctactactacttcttcacg
caaaggacgagcaccaatctatggggcgagtggatgggcgtattgcacggtgacgaggtt
gagtacgtgttcggccatcccctgaacaagtctctcaagtacagcgacaaggaacgagac
ctgtcattgaggatgatactctacttctccgaattcgcctatttgggaaaaccaacgaaa
gaagactctgaatggccatcgtattcgagagacgaaccaaaatacttcatcttcgatgcg
gagaagactggacttggtaaagggccacgtaccacgtattgtgctttctggaacgaattt
ctaccaaagttgaaaggaataccagatccagygcccaatacctgcaaggtgatagcctcg
agcgtgtcggccggcgaggaggggctaggaaattccctagcgatcacggcgctgtcgtcg
atccttgtcctgtcgagagtgatttaa

DBGET integrated database retrieval system