KEGG   Apis mellifera (honey bee): 406154Help
Entry
406154            CDS       T01057                                 

Gene name
PRF, GB13380, chic
Definition
profilin
Orthology
K05759  
profilin
Organism
ame  Apis mellifera (honey bee)
Brite
Exosome [BR:ame04147]
 Exosomal proteins
  Proteins found in most exosomes
   406154 (PRF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG8
AA seq 126 aa AA seqDB search
MSWQDYVDKQLLASRCVTKAAIAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDILTSSG
VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDY
LVSCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattacgttgacaagcagctgctcgcgtctcggtgtgttaccaaagct
gcgattgcaggacacgatggcaatctttgggcaaagtctgaaggcttcgaagtaagtaaa
gaggagttgacgaaattggtccagggatttgaagaacaagatattttgacgtcgtcgggt
gtcaccttggccggcaacaggtacatttacctgtcaggtacggatcgagtgataagggca
aaacttggaaaagtcggcgtccactgcatgaagacgacgcaagcagtagttgtctctctt
tacgaagatcctatacaaccacagcaagccgcatcggtcgttgaaaaacttggggactac
cttgtgtcctgcggctattag

DBGET integrated database retrieval system