KEGG   Apis mellifera (honey bee): 408270Help
Entry
408270            CDS       T01057                                 

Gene name
CytC, GB19293
Definition
mitochondrial cytochrome C
Orthology
K08738  
cytochrome c
Organism
ame  Apis mellifera (honey bee)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    408270 (CytC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG10
AA seq 108 aa AA seqDB search
MGIPAGDPEKGKKIFVQKCAQCHTIESGGKHKVGPNLYGVYGRKTGQAPGYSYTDANKGK
GITWNKETLFEYLENPKKYIPGTKMVFAGLKKPQERADLIAYIEQASK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtattcctgcgggtgatccagaaaaaggaaaaaagatttttgtacaaaaatgtgca
caatgtcatacaattgaatctggtggtaaacacaaagtaggacctaatctttatggagta
tatggtaggaaaactggtcaagcacctggttatagctacacagatgcgaataaaggaaaa
ggtattacttggaacaaggagactttattcgaatatcttgaaaatccaaaaaaatacatt
cctggtacaaaaatggtgtttgctggtttgaagaaaccgcaagaacgtgctgatttaatt
gcatatatcgaacaagcttcaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system