KEGG   Apis mellifera (honey bee): 408331Help
Entry
408331            CDS       T01057                                 

Gene name
HDAC4, GB10010
Definition
histone deacetylase 4
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     408331 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG11
AA seq 1095 aa AA seqDB search
MQGSVNVGGNRMSSEQARASAIATKEDVGYRSVEIASAFTHLPQKEMARDTPGSPMSRPR
DLVGGVGATTTTLTSSGYHTGSADPSTLHGHVLQQKILELQQHHQLQQQILRQQYQAQER
QLAELHEQQMHQLKLWEQQKQLEEQRREKERLEALRKKDKHDHSAIASTEVKQRLQSFLV
NKKQREAAAAANGAVPGTPGYRSWLQPQSAESAGAANASHPYRMPQMLQEKFADDFPLRK
TASEPNLLKVRLKQRVERNMAASRNSPLMARRKDRLLSHLKRKSLLANSSSNPESGPNSP
PTVNNSQASPTAGGNAAAIQEETENTGYGGPLTSSSQQGSLSDLSLFSSPSMPNISLGRP
HVPSGSNTTGTKLATVSEAEVRAAFTARLGMPLTGQMLPGTLPFYPSLTVIEGGEATSTG
GYVHKQMQQNLEHPSVTNRQHPPSAVYHGSTTANPITDTQVAHARLQKAGHRPLGSRTQS
APLPLGHPMLQGGMMAPQTHYEEYLAEKQLHDQQQAHNYLKQQIRQTVLTRVGSRGQANQ
LDEAPETEESAEVIDLTGGKKDMSEESEISKQQRDREQFLQQQRDLMMRHTLQISNESST
AYGGSGGGSGSGSRNNQPSARPLSRALSSPLVHLGPQGGNQSTGDLFARASSHRPTTGLA
YDPLMLKHACVCGETVRGHPEHGGRLQSVWARLSETGLLQRCDRIRSRKATLEEIQTCHS
EAHALLFGTNPMNRQKLDVSKLSQLPIKSFVRLPCGGVGVDSDTTWNELNTAPAARMAVG
CVVDLAFKTAMGDIKNGFAVVRPPGHHAETNQAMGFCFFNSIAIAARLLQQKLDIRKILI
LDWDVHHGNGTQQMFYDDPRVLYLSIHRHDEGNFFPGTGGPTECGAGEGLGYNVNVAWSG
GLNPPMGDAEYLAAFRSIVMPIAKAFDPSIVLVSAGFDAAIGHPAPLGGYKVSPACFGKM
TQQLLGLANGKVVLALEGGYDLAAICDSAQECVRALLGDEPTQLREEELTRAPCQNAVDT
LQKTIAVQMSHWPCVKLNAHTASMSAIEAGQKERDETETVSAMASLSMQQPTNLTTTPEH
SREVSEEPMEQDDAK
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgcagggttcggtgaatgttggaggaaacagaatgtccagcgagcaagcgcgagcaagc
gccatcgcgacgaaagaagacgtgggttacagaagtgtcgagatcgcgtccgcgtttacg
catctaccgcagaaagagatggccagggacacaccaggctccccgatgtccagaccgaga
gacttggtcggcggagttggcgctactacgaccaccttgacatcgagcggttatcacacc
ggctccgcggatccatccacccttcacggccacgtgttgcagcagaagatactcgagcta
caacagcatcatcaacttcaacaacaaattctccggcaacaatatcaggcgcaagaacga
caattggccgaactgcacgagcaacagatgcatcagttgaagctttgggagcagcagaaa
caactggaggagcaaaggagagagaaggagaggctcgaagcgttgaggaagaaggacaaa
cacgatcacagcgcgatcgcttcgacggaggtgaagcaacgacttcagagcttcctcgtg
aacaagaagcaaagggaggccgccgcggctgctaacggggccgtacctggcacacccgga
tacagaagctggttgcagccgcaatcggcggaatcggcgggcgcagcgaacgcctcgcat
ccgtacaggatgccgcagatgttgcaggaaaaattcgccgatgatttccctctacggaaa
acagcctcggagccgaacctgctcaaggtgcgactaaagcaacgcgtggagaggaacatg
gccgcgtcgagaaattcacccctgatggcacgacggaaggatcggctgctgtcgcacctc
aagcggaaatcattgctagcaaattctagtagtaatccagagtccgggcctaattcacca
ccgaccgtgaacaattctcaagcgagccccacagcgggtggaaacgcagcggcgatccaa
gaagagacggagaacaccggttacgggggtccgttgaccagcagcagtcaacaaggtagc
ctatcggatctttcgttgttcagttcaccgtccatgcccaatatctcgttgggacgacct
cacgttccatccggttccaacacgaccggtacgaaattggccacggtctcggaggcagag
gtacgcgcggcgttcaccgcacgactaggaatgccgctcacgggacaaatgttgcccggc
accttgcctttttatccatcgttgacggtaatcgagggaggagaggcgacgtcgaccggt
ggctacgttcacaagcagatgcagcaaaatttggaacatccatcggtaacgaatcggcaa
catccaccgtccgcggtctatcacggtagcacgacggcaaatcccattacggacacgcaa
gtagcgcatgcgaggctgcaaaaggctggtcaccggcctttaggtagtaggactcaatcc
gcgccgttgccgttgggccatccgatgttgcaaggtggcatgatggcgccccagacccat
tacgaagagtacctggcagagaaacaattgcacgaccagcaacaggcgcacaattacctg
aaacagcagatacgtcaaacggtgttgacgcgagtcggatctagggggcaggcgaatcaa
ttggacgaagcgcctgaaaccgaggaatctgccgaggtgatagatcttacaggagggaag
aaagacatgtcggaagagagcgaaatctcgaaacagcaacgggaccgtgaacaattcctc
caacagcagagagatctgatgatgagacacacgttgcagatctcgaacgaatcttcgacg
gcctatggcggcagcgggggcggtagtgggagcggaagcagaaacaatcaacctagcgca
agaccgttatccagagctctttccagcccattggttcatttgggtcctcagggaggaaac
caatccaccggcgatctattcgctcgtgcttcgtctcatcgacctaccaccggtttggcc
tacgacccgttaatgttgaagcatgcttgcgtttgcggcgaaacggttcgaggtcatccc
gagcatggaggaaggttgcaaagcgtgtgggcacgtctctcggaaaccgggttgttgcaa
cgttgcgatcgaatacgttcacggaaagctaccctcgaagagattcaaacgtgtcacagc
gaggctcatgctttactctttggaacgaatccgatgaatcggcaaaagttggacgtatcg
aagctctctcaactgcccatcaagagtttcgtaaggctgccgtgcggtggagtaggcgtc
gattccgacaccacgtggaatgaactgaataccgcgccagctgccagaatggccgtcggc
tgcgtcgtcgatctggcttttaagaccgcaatgggcgacattaagaacggtttcgccgtt
gtacgaccgccgggacatcacgccgaaaccaaccaagccatgggcttctgcttcttcaac
tcgatcgcgatcgctgcacgattgcttcaacagaagctcgatattcggaaaatcttgatc
ttggattgggacgttcatcatgggaacgggacgcagcaaatgttctacgacgatccacga
gtgctctacctgtcgatacacaggcacgacgaaggtaacttctttccagggactggcggg
ccgacagagtgcggggctggcgaaggattgggttacaacgtgaacgtggcatggtccggc
gggctgaatccaccaatgggggacgcggaatacttggccgcgttccgtagcatcgtgatg
ccaatcgcgaaagcgttcgacccgagcatcgtgctcgtctcggcgggtttcgacgcggcc
atcgggcatcccgctccccttggtggttacaaggtgagccccgcttgtttcggaaagatg
acccaacaactgctcggattggcgaacggtaaggttgttcttgccctggagggcggttac
gatttggccgcgatctgcgattccgcccaggaatgcgttcgagccctgctcggggacgaa
cctacccaacttcgagaggaggaattgaccagggcgccttgtcaaaacgcggtcgacacg
ctgcaaaagactatcgccgtgcagatgtctcattggccttgcgtcaagttgaacgcgcac
acggcttcgatgagcgcgatcgaagccggacaaaaggaacgagacgagaccgagacagtg
tccgcgatggcctctttatcgatgcagcagcctaccaatttaacaactaccccagaacat
tcccgagaagtttccgaggagccgatggaacaggacgacgccaaatga

DBGET integrated database retrieval system