KEGG   Apis mellifera (honey bee): 408406Help
Entry
408406            CDS       T01057                                 

Gene name
Cdk4, GB16688
Definition
cyclin-dependent kinase 4
Orthology
K02503  
histidine triad (HIT) family protein
Organism
ame  Apis mellifera (honey bee)
Brite
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   408406 (Cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG13
AA seq 551 aa AA seqDB search
MRGPLESVGAYFLEGSATTKLSVRWPYACPWPVVSVLFRSVHSAVGFYHRVSTGTQSLGL
HDDSSSRRWVTLASGRPCFSSRATPSNRRSRNVVMAGTSRRPSSELGPDLSSPTPPKKSK
FSEASIEGRAEKEHDLSTEELESVEKLSGAVASSSLPENTIEVIPGSASETNPFEIGGES
LESAKQSSLEGPANVAGSSKEGHFASFETIAQMKYSGQKELSGSSNKRSDSDSDVQIQTS
IIGEDASYQELSLIGNGAYGTVYKAKDLNTGQVVALKKVRVPLTADGLPTSTLREIATLK
QLERFEHPHIVRLLDVCQGNYLHLPSADGRSERLDRGLTLWLVFEHVERDLASYMSSCSQ
TGIPPHVVKQMSKEILRGVEFLHSHRIIHRDLKPQNLLVTREGRIKIADFGLAKTYDFEM
RLTSVVVTQWYRAPEVLLGCSYATPVDIWSVGCILAELSRLEPLFPGTSEGDQLDRIFQI
IGTPSQGEWPENVSLSWTAFPYRQAKSFATIISDLNEYGLDLIKGMLTFNPHRRLTAAQA
LRHRYFAEDDS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggtccgctcgaaagtgtcggggcctacttcctcgagggctcggcaacgactaaa
ctctctgtccgctggccgtatgcgtgcccgtggccggtcgtgtcagtacttttcaggtcg
gtccacagtgcagttggcttttaccatcgagtttcgactggcacacagtcgctcgggctg
cacgacgattcgtcgagtcgccgttgggttacgctcgcgagtggtcggccgtgcttctcc
tctcgtgcaacgccgtcaaaccgtagaagtcgaaatgttgtgatggccgggacatctcga
cgtccgagctctgagctcggaccggacctttcatcccccacgccgcccaagaaatcgaaa
ttctccgaggcctcgatcgagggaagagccgagaaggaacatgacttgagcacggaggag
ttggagagcgtggagaaattgtcgggtgcggtggcatcctcctcgttgcctgagaacacg
attgaggtgataccggggagcgcgtcggaaaccaatccgttcgagatcggcggggaatct
ttggaaagcgcgaaacagagcagtttggaggggccggcgaacgtagcaggttcctcgaag
gagggccactttgccagtttcgagacgatcgcacaaatgaagtacagcgggcagaaagag
ttgtccggtagttctaacaagaggtcggattcggacagcgacgtgcaaattcaaacttcg
ataatcggggaggatgcgtcgtatcaggaattgtctttgatcggaaatggcgcttacggc
acggtgtacaaagctaaagacttgaacacgggccaagtcgtggctttgaagaaagttagg
gtgcccctgacggcggacggtctgcctacgtccacgttgagagaaatagccactttgaag
caactggaaagattcgagcatccgcacattgtaagattattggacgtttgtcaagggaat
tatctacacttgccttcagccgatggaaggtcggagagattggatcgaggattgacgttg
tggcttgtgttcgagcacgtggaaagggatctggcatcttacatgtcctcttgttcgcag
acaggaatccctcctcacgtggtgaaacaaatgtcgaaggaaatactcagaggtgtggaa
tttttgcacagtcataggatcatacacagggacttgaaacctcaaaatctgttggtaacc
agggaaggaagaataaaaattgcagatttcggtttagcgaaaacgtacgattttgaaatg
aggttgacttctgtggtcgtgacacaatggtatcgggctccagaagtcctcttaggctgc
tcttatgcaactcctgttgatatttggtctgttggatgcattctagcagagttaagtaga
cttgaacctctatttcctggtacgagcgaaggtgatcaactcgacaggattttccaaata
attggaactccatcgcaaggggaatggcctgaaaatgtatctctcagttggactgctttt
ccttatagacaagcaaaatcttttgcgactataatatctgatctcaatgaatatgggcta
gatttaattaaaggtatgcttacctttaatcctcatagacgattaaccgcggctcaagct
ctcagacatcggtattttgctgaagatgattcgtga

DBGET integrated database retrieval system